SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005778 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005778
Domain Number 1 Region: 574-738
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.65e-20
Family SPRY domain 0.025
Further Details:      
 
Domain Number 2 Region: 211-274
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.27e-16
Family B-box zinc-binding domain 0.00095
Further Details:      
 
Domain Number 3 Region: 417-529
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000018
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number 4 Region: 25-64,118-153
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000544
Family RING finger domain, C3HC4 0.029
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005778
Domain Number - Region: 153-206
Classification Level Classification E-value
Superfamily RING/U-box 0.0148
Family ZZ domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005778   Gene: ENSTNIG00000003198   Transcript: ENSTNIT00000005926
Sequence length 764
Comment pep:novel chromosome:TETRAODON8:12:7819843:7835425:1 gene:ENSTNIG00000003198 transcript:ENSTNIT00000005926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSEDMTEFASIVERIERGEVPIKNIERELICPSCKELFTHPLILPCQHSICHKCVREL
LLINHEDSFDAGSECSLPGSPRSRVPSPSMERLDRLVRSGSISSPGWRRGSVTPRVTTIP
CPGCQHDIDLGERGISMLFRNFTLESIVERYRQAARAAVAIMCNVCKPPQQQEATKSCMD
CRASYCNECFKLNHPWGTPKAQHEYVGPTTNFRPKVLMCPEHEMEKVNMYCEVCRRPVCH
LCKLGGSHANHKVTSMSNAYKILKEKLAKSIHYLISKEDQVRTQITGLEQLISQTEENGQ
LAERRATEHFERLLETLQERKSEMLRSIEQSRNRRVDQLRAQVEEYQGMLENSGLVGYAQ
EVLKETDQSCFVQTAKQLHVRIQKATESLRTFHPSADPCFDEFVLDTSREETLLKEICFG
GVPDPPLIDLSSSKVYNEASICWRLPEDHQPTDHQILEYRRLGGSNLSPSQEDGEDSRSW
RTTERVHGSSTVVCDLDPESLYAFRVRSCRNSIFSPYSPEVTFHTPPAPAFGFLFSDKCG
FSTERLILSKRRDAVENVAGMAFLLAADRVQTGSYINLDYIIGDTGISQGRHYWAFRVEP
HSYMVKVGVASDSKLLEWFHNPRDTSSPRYDHDSGHDSGSEDTCYELCQPFTLLTVGMGK
LLIPKASSSSSISSATATAPTTGDPGNRVLPMPQRMGVCLDYDACRVYFYDADTMRCLYE
RQVDCSGTMYPAFGLMGSGKIQLEEFITAKRERTVCVGGPARLF
Download sequence
Identical sequences H3CC06
ENSTNIP00000005778 99883.ENSTNIP00000005778 ENSTNIP00000005778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]