SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005790 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005790
Domain Number 1 Region: 245-297
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000732
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 2 Region: 68-115
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000759
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 123-169
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000863
Family TSP-1 type 1 repeat 0.0007
Further Details:      
 
Domain Number 4 Region: 301-362
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000549
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 176-237
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000103
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 6 Region: 371-402
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000562
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005790   Gene: ENSTNIG00000003209   Transcript: ENSTNIT00000005938
Sequence length 446
Comment pep:novel chromosome:TETRAODON8:3:15184638:15188013:1 gene:ENSTNIG00000003209 transcript:ENSTNIT00000005938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVQAALTVLLVLASVERSDAVGVRCFARFIQGVCADELGEVEEDDCCQNPHYGHQDTDG
QCRSCGSPVWSPWSSWSFCNVLCGQGVSQRTRTCFGIAQSECEDAENKLEVRPCNGTCCD
AKGWSSWQAWSSCSVSCGEGGVRTRRRTCSGPPECGAACTGPSEETEDCPTSTCPVHGGW
SGWSGWSGCSGSCIAGQHETDQPSRTRHRSCSNPAPSGHTTPPGNRCPGDEVQRQDCSEL
PNCPVDGGWSPWTPFSACPVTCGVGLQLSDRKCNSPAAAHGGRPCPGEQRRSRLCQTNVH
CPVDGAWSPWSEWSQCKSPFGQRDVRCKQQRGSQKRRRECLYRAHNGSICSGELQSQTRA
CYDVNRCYFKGSWEGWEPWSLCQPPCGGTSRRSRKRICQPDYSGYHYSRLPMPPAVFGTP
AADCGATPDGGPAEEVQTCFNAPPCS
Download sequence
Identical sequences H3CC18
ENSTNIP00000005790 ENSTNIP00000005790 99883.ENSTNIP00000005790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]