SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005793 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005793
Domain Number 1 Region: 202-272
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.57e-22
Family Thyroglobulin type-1 domain 0.00021
Further Details:      
 
Domain Number 2 Region: 27-110
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.75e-20
Family Growth factor receptor domain 0.0000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005793   Gene: ENSTNIG00000003211   Transcript: ENSTNIT00000005941
Sequence length 287
Comment pep:novel chromosome:TETRAODON8:15_random:146701:150243:1 gene:ENSTNIG00000003211 transcript:ENSTNIT00000005941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPCLRALCMTFVLASFTCRSGAVGPVIKCEPCDAGARLLCKPLPKDCVEKVREPGCGCC
VTCALPFGQPCGIYTSRCGSGLTCQHQPGETKPLQALLEGRGICVNATNKRLTPKPTPPV
NELPENIETQEEERNSTSSGLQTPDSTHRPMGSPRPPLNPFLPSAKSDVLRREQKRTQSF
KMEELPGPLITDQQNFSVETEQEPDYGPCRREIESILSGLKITDILNPRGFRIPNCDKKG
FYKKKQCRPSKGRKRGFCWCVDKYGQPLPGFHGKERADAQYYNSETQ
Download sequence
Identical sequences H3CC21
ENSTNIP00000005793 99883.ENSTNIP00000005793 ENSTNIP00000005793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]