SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005885 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005885
Domain Number 1 Region: 8-174
Classification Level Classification E-value
Superfamily EF-hand 1.86e-38
Family Calmodulin-like 0.0000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005885   Gene: ENSTNIG00000003301   Transcript: ENSTNIT00000006033
Sequence length 187
Comment pep:novel chromosome:TETRAODON8:5:12989775:12991118:-1 gene:ENSTNIG00000003301 transcript:ENSTNIT00000006033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQDQSHTEELDLAQVQELCILFMKECPSGALHLHEFKRMFGVQSSSVEESVYMETIFHS
FDTNKDNALDFLEYVAALHLILRGNLEDRLKWSFKMYDKDGNGKLDRQEVKRIIKIIHKI
KLQSSHVSMTPSQICDRIFELVDKNQDGQISLSEFMEGAQKDEWVMNLLKLDINATSWVI
NNCDKRP
Download sequence
Identical sequences Q4T926
ENSTNIP00000005885 99883.ENSTNIP00000005885 ENSTNIP00000005885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]