SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006041 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006041
Domain Number 1 Region: 514-652
Classification Level Classification E-value
Superfamily FAS1 domain 9.29e-26
Family FAS1 domain 0.001
Further Details:      
 
Domain Number 2 Region: 393-503
Classification Level Classification E-value
Superfamily FAS1 domain 4.19e-20
Family FAS1 domain 0.0025
Further Details:      
 
Domain Number 3 Region: 235-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000691
Family EGF-like domain of nidogen-1 0.086
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006041
Domain Number - Region: 323-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000542
Family EGF-like domain of nidogen-1 0.079
Further Details:      
 
Domain Number - Region: 198-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000995
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 275-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00726
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 117-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006041   Gene: ENSTNIG00000003454   Transcript: ENSTNIT00000006189
Sequence length 702
Comment pep:novel chromosome:TETRAODON8:Un_random:22953842:22958604:1 gene:ENSTNIG00000003454 transcript:ENSTNIT00000006189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGCVKTLLLCLMVILERRSSAAALQCVRVNFCTNATVLRTRVACHSCTISMLRSCPAGF
RQTPGSGARDCTFHIRTSSLRLHVPGCSFECYQEVEVKSCCPGFWGPDCAAECPERADTP
CSGHGACSDGLGGTGVCSCQQPGFVGTSCEDCTPGRYGPTCSSECSCVHGLCDSGIAGSG
QCTCFSGYSGPTCDRERPECAALGCLQNSRCVEEAATGLLRCQCLHGYQKSGQQCLPIDP
CLQNVCHAHAACVHTGPGQHTCTCNHGYSGDGRVCVAVDPCQSQQGGCSVASQRCVYDGP
GTAHCECLPGFERVPDGSCRLEEACQPHTCHRNADCTTVGPATPRCTCRQGYVGNGKVCY
GNIVERLQELNTEPGGAWSGQLSAAISLFAGSVSWPLQNLGPFTAFVPINKAFRGTPVKT
LTADPSSARYLCQLHLVAGVMTLDTLKKSDQFYTLTGKSAEVDASGGDLETRIRLHGSRK
KGAIVQAGIMASNGMIHLINKLMDSVAPIVQSDAQENMMKIISDYGKFSTLKPLLQKADL
EAMLDLPGPITVFAPISSAFDLMAEGHLTYLRTAEGHAKLVELLRNHVITSAALDVFNIV
STPSVVSLANQVLTINVTDNGQILVGGAAVLEAAVEAKNGRLYVMDGVLVPASIRPLLPH
RCDVTESRIIKVGSSSICWSPGSRQVSPPAPPASATTSAVLL
Download sequence
Identical sequences H3CCR8
ENSTNIP00000006041 99883.ENSTNIP00000006041 ENSTNIP00000006041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]