SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006119 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006119
Domain Number 1 Region: 170-394
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.13e-47
Family Eukaryotic proteases 0.00049
Further Details:      
 
Domain Number 2 Region: 73-171
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000916
Family Hepsin, N-terminal domain 0.042
Further Details:      
 
Domain Number 3 Region: 40-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006119   Gene: ENSTNIG00000003531   Transcript: ENSTNIT00000006267
Sequence length 394
Comment pep:novel chromosome:TETRAODON8:Un_random:18017318:18019584:1 gene:ENSTNIG00000003531 transcript:ENSTNIT00000006267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCVTSDWKRRCVKLGVTSVTSLLLLLLLAGVLLAYYSSSACIHGVPCGDGSCVWESQWCD
GLRHCPAGQDEADCVRLHGSRSVLQIYASGGWRSVCSQGWSARQARASCLELGYSRSFHA
AAVCAQVCVTDRAAATSVWLRLQPLRLSSNSDACPGDSVVTLQCTDCGRGVNSSGGAWPW
QVSLQLAGSHRCGGAIVSPYWLVTAACCVAREPRPAAWTVYTITANALRPLFAPARFVSR
VLVHEGYNQHSQANDIALLRLAEALDLTDGSLVPVCLPNAGLNISQQQPGWISHLRPSGS
GSLALAAERVSILDGVECNRSPQYRGRVGPDMLCAQGTSAAACQAESGSPLVTLEDGVWW
LIGESIWAERCTEHNTGVHGNISYFQAWIRQQMK
Download sequence
Identical sequences H3CCZ6
ENSTNIP00000006119 99883.ENSTNIP00000006119 ENSTNIP00000006119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]