SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006155 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006155
Domain Number 1 Region: 131-243
Classification Level Classification E-value
Superfamily Cap-Gly domain 8.77e-17
Family Cap-Gly domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006155   Gene: ENSTNIG00000003565   Transcript: ENSTNIT00000006303
Sequence length 267
Comment pep:novel chromosome:TETRAODON8:Un_random:60091466:60095934:-1 gene:ENSTNIG00000003565 transcript:ENSTNIT00000006303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCQIVPRVVTNFFVLQSTASTFLDGGYPACHAAMSSALWSQEKPSGGFREDWRFYMVIKE
CIVEKPSQKTLRILRGSLGQACQERNSLGRTLTPCKGKKSLRILDQTNVVLSLDERDVLE
LDENLAELLFPITNCEERYALLCNKSRLDRVRDIDCGSKVRVQLRSGDEPLPGVVRFKGS
LLPDRALSGIWFGVELLDNPIGDWNGVFDGKLLCNFASLEHTRLVPVCDVMPEYSIQDQR
LQKHSFAPRGNNNTDKSSSGQSKPKSK
Download sequence
Identical sequences H3CD32
99883.ENSTNIP00000006155 ENSTNIP00000006155 ENSTNIP00000006155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]