SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006195 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006195
Domain Number 1 Region: 451-636
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.34e-25
Family Pectin methylesterase 0.067
Further Details:      
 
Domain Number 2 Region: 197-253,291-419
Classification Level Classification E-value
Superfamily Pectin lyase-like 6e-23
Family Pectin methylesterase 0.052
Further Details:      
 
Domain Number 3 Region: 592-756
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.57e-21
Family Galacturonase 0.069
Further Details:      
 
Domain Number 4 Region: 86-169
Classification Level Classification E-value
Superfamily F-box domain 4.97e-20
Family F-box domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006195   Gene: ENSTNIG00000003602   Transcript: ENSTNIT00000006343
Sequence length 857
Comment pep:novel chromosome:TETRAODON8:2:18429:23144:1 gene:ENSTNIG00000003602 transcript:ENSTNIT00000006343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEMAIEESGPGAQNSPYQLRRKTLHPKRSAAASTAASASACPNKGPMEGASTSSTETFGH
RAKRARLSGKSHDLPAAPAEQYLQQKLPDEVILKIFSYLLEQDLCQAACVCKRFSQLAND
PILWKRLYMDVFEYTRPMMHPEPGRFYQVSPEEYEHPNPWKESFQQLYKGAHVKPGFAEH
FYSNPGRYKGRENMLYYDTIEDALGGVQEAHFDGLIFVHSGIYTDEWIYIESPITMIGAA
PGKVADKVVIENTRDSTFVFMEGSEDAYVGYMTIKFNPDDKSAQHHNAHHCLEITVNCSP
NIDHCIIRSTCTVGSAVCVSGQGACPTIKHCNISDCENVGLYITDHAQGIYEDNEISNNA
LAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFENCNIHRNRIAGFEVKAYANPTV
VRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNAIYNGNQGGVY
IFGDGRGLIESNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEV
YSNTLAGVWVTTGSTPVLRKNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGS
NPKIRRNKIWGGQNGGILVYNSGLGFIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGDG
GICIFNHADFRRRGLLEENDIFRNAQAGVLISTNSHPILRKNRIFDGFAAGIEITNHATA
TLEGNQIFNNRFGGLFASGVNVTMKDNKILNNQDAIEKAVSRGQCLYKISSYTSYPMHDF
YRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTD
TLYDSAPPIESNTLQHN
Download sequence
Identical sequences H3CD72
ENSTNIP00000006195 ENSTNIP00000006195 99883.ENSTNIP00000006195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]