SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006342 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006342
Domain Number 1 Region: 241-448
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.85e-51
Family Reprolysin-like 0.00054
Further Details:      
 
Domain Number 2 Region: 1067-1124
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000144
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 936-995
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 877-934
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000902
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 1001-1062
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000249
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006342
Domain Number - Region: 826-874
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00123
Family TSP-1 type 1 repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006342   Gene: ENSTNIG00000003742   Transcript: ENSTNIT00000006491
Sequence length 1168
Comment pep:novel chromosome:TETRAODON8:8:4365844:4391525:-1 gene:ENSTNIG00000003742 transcript:ENSTNIT00000006491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYEIVSPYEVTHQGQYISHEVSHHHRRGRRSLTPDTSSTDETIHFRLNGLGQEFHMELRE
TSGGLIAPGFTIQVLGKNGTKSLRAYQKHDLCFYQGSLRSRVNSSVALSTCTGMSGLIRT
PDADYILRPLSRDLAQKENFMAPSSHQPHILYKWSEQKGPGPRARWKRSVNSSRHTSPQA
SGNEDQENQQQQSDYSHGERQRQHFCGRRKKYMPKPPEDDAFILPDEYKFIPRNKRANQH
SRKLNVEMLVVVDGKMMDNHGHENITTYVLTVLNMVSSLFKDGTIGGNINIVIVGLVLLD
EEQDGLVINHHADHTLNSFCHWQSTLRGREGRHHDHAILLTGLDICSWKNEPCDTLAGFA
PISGMCSRYRSCTINEDTGLGLAFTIAHESGHNFGMVHDGEGNVCKKSEGNIMSPTLAGH
NGIFSWSACSRQYLSRFLNSAQSLCLSDEPRAVEEYRYPEQLPGELYDADTQCKWQFGEK
AKLCTLDFKKEGRLINSLFSHTHKINSQRYNAAHGLMTKYTLECCQWESLLVALSLSHYY
CQWWSCKYSVRLLCCSLESRIIELHNSSIMNGKNCVFFILGDLECCEQNRVGKRCHDDRX
YVEFMFYIWFVCPHHFTLESSCQKSICTLYLFFVLSVFFYDFSLRLMFLCPCSSVGHSLT
IASHCRQIGTCGSVGGWRVQQITGFCSIRQVLCSIFLSNTLCRHWGFGFYYSPSACTIPL
GAEGIRVMEQNTSSSYLAVRDAQRRYYLNGHWTVDWPGRHVIAGAIFEYKRPYNRPESLI
STGPTNETLVIEVLLQGWNPGVRWEYTLKKADEKRRHNYTWAIVRSQCSATCAGGLMSTK
TACYKDMRVQVNTSYCNPRSRPATGLVPCNTQPCPASWSVGEWGACSQSCGGGEQKRPVQ
CVQRTSQTDTANLSDAQCVQPTLARRQACNTHSCPPVWATGPWSQCSRKCGSGLRKRTVL
CTSTKQGVDMHTLPDHLCTGLPKPSSQESCFIKRCQKLRKVQWFVSTWQECSATCGRGYQ
TRFIKCAEKDAAGKYRELADKKCHHVPKPIVELQKLCLLKECPPLPHPSPAAEWSSTPWS
QCTVTCGGGVQSRTVQCLVQGKPSPDCAVHLKPLMSQACNTNFCPQPDKKADLACRDYFN
WCYLVPQHGVCNHKFYGKQCCQSCSNSN
Download sequence
Identical sequences H3CDL9
99883.ENSTNIP00000006342 ENSTNIP00000006342 ENSTNIP00000006342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]