SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006352 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006352
Domain Number 1 Region: 73-197
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000115
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 2 Region: 7-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 50-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000699
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006352   Gene: ENSTNIG00000003752   Transcript: ENSTNIT00000006501
Sequence length 198
Comment pep:novel chromosome:TETRAODON8:Un_random:61784688:61786504:1 gene:ENSTNIG00000003752 transcript:ENSTNIT00000006501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYRSATCEQKVNQCDSNPCHNNATCHPGPLGFDCSCPAGFTGPTCAQLVNFCALNPCAHG
VCRSVGDNYRCLCVPGYHGLYCEEEYNECLSAPCQNYATCRDLINAYECICPPQYEGRHC
EIYKDPCLKVHCNNRGYCDSAGLNASCVCPPGYLGKKCEIDINECKSTPCHHGGTCIDQS
NGFSCHCPPGWVGPSCEI
Download sequence
Identical sequences H3CDM9
ENSTNIP00000006352 99883.ENSTNIP00000006352 ENSTNIP00000006352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]