SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006464 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006464
Domain Number 1 Region: 44-151
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-31
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 2 Region: 289-392
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-31
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 3 Region: 160-267
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-28
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 4 Region: 394-469
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-16
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 5 Region: 1-40
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000222
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006464   Gene: ENSTNIG00000003861   Transcript: ENSTNIT00000006614
Sequence length 470
Comment pep:novel chromosome:TETRAODON8:Un_random:10050628:10054476:-1 gene:ENSTNIG00000003861 transcript:ENSTNIT00000006614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRYCGNQLPHPVTSFSNSLFVSFVSDTSISSRGFRATYSASTSSCGGDLVMESGAFNSPN
YPDPYPANVECVWTIRSSPGNRLQLSFMDFSLHGGSACQNDFLEIREGNWTGPLVGCFSG
SSLPANYTSVTAHILWIRFVSDASVSGAGFQSHLLSLFGNDLTGDLGQIASPLYPRTYPN
SANYRWTITVDGDAYIQIRFLDMDIEDAYDCYYDHLKVRREALALFVSFCGTSRPGPLRS
SASSITLQFQSDTVVGGQGFLLEWTAVQDSGPPPTLEPGACGGIVTAGDAPGFLFSPGWP
ENYPPNLECSWLIRSDDSTVELNLLSLDIEDFPMCYLDSLVIRDGPSSVSPVLATVCGRD
PPGSLHSTGDSMFLHFSSDSIISGRGFNASYSKGCGGLLHVDRGSVSSPNYPQNYSPRLN
CSWHVMVTPGFRVSASFQSPFQIQGYGTQCSSGDYLEVRNGPDASSPLLG
Download sequence
Identical sequences H3CDZ0
99883.ENSTNIP00000006464 ENSTNIP00000006464 ENSTNIP00000006464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]