SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006506 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006506
Domain Number 1 Region: 2-181,229-335
Classification Level Classification E-value
Superfamily Ras GEF 9.68e-46
Family Ras GEF 0.0045
Further Details:      
 
Domain Number 2 Region: 424-509
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.03e-33
Family Ras-binding domain, RBD 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006506   Gene: ENSTNIG00000003899   Transcript: ENSTNIT00000006656
Sequence length 543
Comment pep:novel chromosome:TETRAODON8:8:1659325:1665349:-1 gene:ENSTNIG00000003899 transcript:ENSTNIT00000006656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSTVFSTWLSEYPEDFRSLGEPSRLLHLAQLLPQDSSSAAELRAHVLRIAEELSEKALL
PDMHKGQSGVSSPPPDASKFEPTNFLGFPAKLIAEQLTKIETELFVRLVPYHCLGSLWSQ
RDKKGREGVCWSVRATIRQFNRLATGGHIQICQPGQQTCSKGRLYEAWDARGNHPIIRKC
TAHANNRQFCLKGFVFLCSFLRFRMDVVLFSFQLEYVVPLDVKSLIMTQSSAQGTVPYLG
IFLTDLTMLDTAVKDRLDNGYINFDKRRREFEVLAQIRLLQSSCKNCIFTVDKDFVRWYQ
SVPTLTEEESYRLSSVIEAPSEPSPRALPPTVIVTQCPDLRSSQNSLVSDSDNLFDFPSP
VNHLLSKLTKHMRSPSVSCLDVDKSPPTNDSTPATLTPSTPTKSHRRSASCGNNPTGNIQ
SSGSDMHIIRIRMDLQDGNLYRSILVTSNDKTPTVISSALEKHNQDPKRASRYELIQLLP
EGKELVIPATGNVFYAMTTSSVDFLLRKREGDTPLGSEPINTETSATFPRIKAKGKRLVR
TLF
Download sequence
Identical sequences H3CE32
ENSTNIP00000006506 99883.ENSTNIP00000006506 ENSTNIP00000006506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]