SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006568 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006568
Domain Number 1 Region: 7-302
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-64
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 568-656
Classification Level Classification E-value
Superfamily DEATH domain 1.41e-18
Family DEATH domain, DD 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006568
Domain Number - Region: 520-574
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0169
Family Filamentous hemagglutinin FhaB, secretion domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006568   Gene: ENSTNIG00000003960   Transcript: ENSTNIT00000006719
Sequence length 659
Comment pep:novel chromosome:TETRAODON8:15_random:263973:267852:-1 gene:ENSTNIG00000003960 transcript:ENSTNIT00000006719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAPQLSLHMRSTDFIKKEPLDYGGFGDVYLCLHVTLGQVVMKTMYTGPLRNEDRKKLLIE
EGSIMASLNHERVVKLLGVIMEDGDCSLVMELIPRGNLLVMLETVSVPLSVKGRIVLEIL
EAMLYFSEKDIIHKDIKPENILVDKDFHIKIADLGLAISQSWSKLTKEESRRRSHKGQSV
GARGAGTLSYMAPEHLESIHAASTEKSDVYSFGIVVWVVLTGVEPYANARSEDQICQCVR
NGDRPAESCIPADTPQQLVHLMRWCWHQKPQDRPTFKEGYNYFHPFYMEKLAPCVEKDLQ
KLRTMYEGPEDLVKKMKSLSVSQDCSLGEMNRLRSSTIPSKVAVSAGLQNEIRSEISNCP
ASLVSSESVSVPVEASVEDLHGIQAQPQHIQSDAAVSSPLPLEEKLNQELQYHERGNYGG
GTQFDIANGNFYSTSNPFLPNLHPDPTVTHLGQDRLSSSSVHSFTRAEPVHPIGQDERWY
PPSGDLSLSMQSSAPSKPHLATSVSMPFIPQPNRENHWPLIIQNANGIQIGSNNQMNFKS
LSASAGDSCSFSIKQGIQKYAFVCSGGHAVTEKHLDLLRDNIGAKWKRCARRLGLTDVEI
ENIEYKSHRDGLSEMVHQMLDCWKMKEGSYGCTIGKLLEALEGNIKVDLIQKILDTCNS
Download sequence
Identical sequences H3CE94
99883.ENSTNIP00000006568 ENSTNIP00000006568 ENSTNIP00000006568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]