SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006683 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006683
Domain Number 1 Region: 259-391
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.03e-20
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 15-164
Classification Level Classification E-value
Superfamily C-type lectin-like 1.01e-19
Family C-type lectin domain 0.0031
Further Details:      
 
Domain Number 3 Region: 392-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000309
Family EGF-type module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006683   Gene: ENSTNIG00000004072   Transcript: ENSTNIT00000006834
Sequence length 431
Comment pep:novel chromosome:TETRAODON8:Un_random:66115266:66116558:1 gene:ENSTNIG00000004072 transcript:ENSTNIT00000006834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPSSALDLDLRETDALCTDDGCFMVHFQRKTFLESWRSCKDNGGNLAIIKRKEDAGTIGR
LFASADLRHSRTKVQAWIGLQRHPRQCSATLPLRGFSWTTGDQDTDYTNWQGEDSPGACL
APRCVVVEYDAQKRSDNLKWVDGPCVAHTDGYLCHYAYGGMCPTLRSEGAGKALYVTPFH
LRSTLLTLVPPGTVATLPCPSDTERESSVLCTLRDDGLARWSRDQPFCSGPPVSRHWCQV
DNGGCEHFCRAAGVNFYCECAEGYQLAGNGQNCEPLDVCKESPCKFECLPISDSYRCACP
DGYMLAPDEHDCMDVDECLQSPCEHLCVNSPGSFECRCREGYLLDEDGACEDADECMANP
CEHACENTAGSHVCHCELGFSPIPEDPSRCQDTDECRMAGTCQQICVNFEGSFQCYCEEG
HRLLPDMYSCE
Download sequence
Identical sequences Q4T5R2
99883.ENSTNIP00000006683 ENSTNIP00000006683 ENSTNIP00000006683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]