SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006685 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006685
Domain Number 1 Region: 164-363
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.46e-52
Family Prokaryotic proteases 0.000000566
Further Details:      
 
Domain Number 2 Region: 379-474
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-18
Family HtrA-like serine proteases 0.0022
Further Details:      
 
Domain Number 3 Region: 36-113
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000471
Family Growth factor receptor domain 0.0017
Further Details:      
 
Domain Number 4 Region: 100-146
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000177
Family Ovomucoid domain III-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006685   Gene: ENSTNIG00000004074   Transcript: ENSTNIT00000006836
Sequence length 478
Comment pep:novel chromosome:TETRAODON8:Un_random:66124240:66129817:-1 gene:ENSTNIG00000004074 transcript:ENSTNIT00000006836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KERLRVTERSSMNLLLRAPLLLYLLDVLGAQPEAKCPTRCDVSACPSPGCPGGYVPDRCN
CCLVCAHGEGEACGRKDDLPCGDGLECQHPAGRRLAPGVCRCKLSSEVCGSDGKTYGNAC
QLQASSRKALQQGQPGLRQVRRGPCESGSGSSRASSPRYKFNFIADVVEKIAPAVVHIEL
FLRHPLFGRTVPLSSGSGFLVSENGLIVTNAHVVSSTSPGTAQQHLKVQMQNGDTYEASI
KDIDKKSDIATIKVEPQVKLPVLFLGQSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQR
DGRELGLRDSDMDYVQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPSDRITQ
FLSHALQRHGKDAKSAKKRFIGIRMLTVTPGLMEELKQQNPDFPDIGGGIYVHGVVPLSP
ADKGGIKEGDVLVKLNGRPLASTADLQGALQEEAALLLEVRRGNDDLLFNIQPDLILQ
Download sequence
Identical sequences H3CEL1
ENSTNIP00000006685 ENSTNIP00000006685 99883.ENSTNIP00000006685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]