SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006726 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006726
Domain Number 1 Region: 1080-1162
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-18
Family I set domains 0.025
Further Details:      
 
Domain Number 2 Region: 709-765
Classification Level Classification E-value
Superfamily BPTI-like 3.41e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0036
Further Details:      
 
Domain Number 3 Region: 862-942
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000171
Family I set domains 0.029
Further Details:      
 
Domain Number 4 Region: 992-1071
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000183
Family I set domains 0.028
Further Details:      
 
Domain Number 5 Region: 308-364
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000405
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 6 Region: 29-80
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000471
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 7 Region: 369-427
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000955
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 8 Region: 422-483
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000109
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 9 Region: 488-542
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006726   Gene: ENSTNIG00000004109   Transcript: ENSTNIT00000006877
Sequence length 1220
Comment pep:novel chromosome:TETRAODON8:10:12074852:12086024:-1 gene:ENSTNIG00000004109 transcript:ENSTNIT00000006877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMLPVLVTLQLLLPPVILVGNQIPSLDYWDAWGPYGECSRSCGSGVTTRTRRCITSRAD
GGHNCVGPDKSYRLCNIQDCPEGSKDFREDQCSQFDGTDFQGNRYKWLPYYVTAENPCEL
NCMPRGENFFYRHRSAVVDGTPCHPGRRDICVEGVCKRLGCDNMLDSSQQEDPCLQCGGT
GQSCYRVQNSFSMRDLQTGYNQMFVIPVGATTISIRETVATRNYLGPAVKNLRGEYYLNG
HWVIEFSRATPIAGTTLYYQRGAEGDNVPETITGRGPTTEPLVIELISQEPNQGVEYEFY
LPRGGSREGYYWSFGSWSACSRECGSGYQSRLVFCTIDNEVYPDYLCASLQRPQSNRTCN
PHPCPQTRSWRTGDWNQCSVTCGGGSQVRTVECISHDSAGPRVVEDAVCAAYAEAPPSLQ
TCNMHRCPEYRVAGWSACSVTCGSGEQTREVTCMDSRGMKIDESSCNRLLRPHTVQRCEM
AACPAQMSWHVGDWGLCSRSCGSGSRNREVICSDRERNLYPVHACSSRPMPSTVERCNTQ
PCHRPQLVPSFQDPLGHNKTQTVFQPYAQEHATAHRPEADLSQTNTVYDPHSTAPVLHCS
QTHYGCCPDGHTPAGGPQGLGCPRGPAPVRPSCTRSSYGCCQDGVTASPGPNGEGCEEYV
APASRAAPSLPTENAAECRTTAYGCCYDRTTAASGPNGEGCPNPPNHIERSICSLPRAAG
SCSTWVSRYHYDIIASKCVHFWFGSCHGNSNNFASLEECQRACQVPEPSSADPAKEASGP
VRPASPAGGSTGGRSRNMGRIFTVHRAPGGSASRRATSAATHANRGRSHLGYRRPFPATA
AQHSGPAASLTVGGVTIDKDDPSKVEALVGQTVVLPCRVSPPPSSTVTVEWRRDGVPLSS
NRHHQQPNGSLLIGPLTKLDSGWFLCVATREQERDHRYIYLSATGDKTTFCENPVALFAL
ISEGPPQQNPTSLPKDGFPRFSIERSSSSLLEMRSGQMARLPCKIVPASAVQSVNIQWTK
DGQIFSDSRHAQLSDGTLIISSLKANDAGIYTCTASTQQQLEQRQLQLKVQSEFFCLSLP
SFLPYPKGSTAQLPCVVSGDNVSIGWSRNGVPVHPDGRNVLVSSDGSLVINKVKPSDEGT
YTCNAYTGIYSVSATAEVRVTKDAVPSTAVPPECFDQPELANCKLIVYARLCSNSYYSSF
CCASCARHSQRNARFAGRLG
Download sequence
Identical sequences H3CEQ2
ENSTNIP00000006726 ENSTNIP00000006726 99883.ENSTNIP00000006726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]