SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006770 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006770
Domain Number 1 Region: 77-144
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000418
Family IP3 receptor type 1 binding core, domain 2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006770   Gene: ENSTNIG00000004149   Transcript: ENSTNIT00000006921
Sequence length 443
Comment pep:novel chromosome:TETRAODON8:2:3336805:3340416:1 gene:ENSTNIG00000004149 transcript:ENSTNIT00000006921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFILLHHQYDGIREVMRALPKTYTINSVSIEDTINLLAALGQIRALLSVRMGKEEEKSMI
RGLGNIMNNKVFYQHPNLMRALGMHETVMDVMVNVLSGGHSKEITFPKMVANCCRFLCYF
CRISRQNQRAMFEHLSYLLENSSVGLASPSMRGSTPLDVAAASVMDNNELALALREPDLE
KVVQYLAGCGLQSCGMLVCKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRL
LIRRPECFGPALRGEGGDGLLAAMKEAIKISQDSSKDRPMPKSGIKKTLQNSQKEEEKKD
DIIHIGNSIMTFYAALIDLLGRCAPEKHLIHAGKGEAIRIKAILRSLVPVEDLVGVISIP
FFIPSLKKDGLVVEPDMSAGFCPDHKAAMVLFLERVYGIEDQNFLLYLLEFGFLPDMRAA
ASLETVSVVHEVEIQRIIEILSN
Download sequence
Identical sequences H3CEU6
ENSTNIP00000006770 ENSTNIP00000006770 99883.ENSTNIP00000006770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]