SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006779 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006779
Domain Number 1 Region: 478-681
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.65e-36
Family Laminin G-like module 0.00087
Further Details:      
 
Domain Number 2 Region: 693-884
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-35
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 3 Region: 889-1059
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.57e-31
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 4 Region: 8-179
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.22e-29
Family Laminin G-like module 0.0066
Further Details:      
 
Domain Number 5 Region: 1106-1237,1273-1307
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-21
Family Laminin G-like module 0.000046
Further Details:      
 
Domain Number 6 Region: 352-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000752
Family Laminin G-like module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006779
Domain Number - Region: 199-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 1080-1120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00219
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006779   Gene: ENSTNIG00000004158   Transcript: ENSTNIT00000006930
Sequence length 1502
Comment pep:novel chromosome:TETRAODON8:Un_random:32712997:32786618:1 gene:ENSTNIG00000004158 transcript:ENSTNIT00000006930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGSIFLNFFGLRFFIGLQVFLSTCLGLEFLGTPGQWARYLRWDASTRGDLSFQFKTEVSE
ALLLYFDDGGYCDFLQLSVSEGRLQLRFSIDCAETTIVSNRRVDDGSWHFAALSRYNQRT
VLALDGQAKADEVRPQRLFMKIVSDLFLGGVPQDIRNGALTLPTVRNMQPFRGTVTDLKY
GVSQPQFLGSLKVLLESEGWCTKNLCENGGTCLVVDGEPVCDCSKTEYKGRFCNEGEFEF
NNIRSGLAHMMAEQGSSRNDGNALGLKHCLFQGQGEGTYVVTNKENKGIFKCLVKKPLYI
NSPDLQLSFLKIVYIALLNHTGSSFDYLFLSEIKSEFYSILFSFYSVRMTKIISICSGSL
RDEHCSHVVSILSFFSETSFLNDSILSRSICRVEVTISVDGILTTTGYTQEDYTMLGSDD
FFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIVDPKMKIQGEVSYK
CENVPTLDPISFETPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQERKDAAR
SQKNTKVDFFAVELLDGSLYLLLDMGSGTIKVKATQTKVNDGAWYHVDIQRDGRSGTISV
NSRRTPFTASGESEILDLEGDMYLGGLPTDRTNLILPTELWTAMLNYGYVGCVRDLFIDG
RSKDIRQIAEAQNGAGIKPSCNKQPGKQCESYPCKNRGVCKEGWNRFICDCTGTGYWSRT
CEREASILSYDGSMYMKVVMPTIMHTEAEDVSLRFRSQRAYGLLMATTSRDSADTLRIEL
DGGRVKLMVNLDCIRINCNTSKGPETLYAGLKLNDNEWHTVRVVRRGKTYKLTVDDDVAE
AGQMVGDHTRLEFHNIETGTMTERRFVSSIPSSFIGHLQSLRFNGMLYIDLCKNGDIDYC
ELNARFGIRSIIADPVTFKTKSSYLSLATLQAYTSMHLFFQFKTTSPDGFIIFNSGDGND
FIAVELVKGYIHYVFDLGNGPHLIKGKSEKALNDNQWHNVAITRDTATLTSFSLTTKLRL
FFSGHLFIAGLGPGMYGNLPKLVASREGFQGCLASVDLNGRLPDLLSDALFRSGQIERGC
EGPSTTCQEDSCANMGICIQQWENYTCDCSMTSYTGTQCNDLPIWVFVFPKRGHTKRFPE
NQGPSVAAATYSISIQDTATTADMVSVNSRGLPDFVIIQQGKIGVTFNIGTVDISVEESS
TPVNDGKYHVVRFTRNGGNATLQVDNWAINEHFPTDFKGNSDIERYQMASKKIPFKYTRP
VEEWLQEKGRQLTIFNTQATVAIGGSDRSRPFQGQLSGLYYNGLKVLSMAAEGNPNIKMN
GSVRLVGDVPSVAGSARTTAMPPEMSTTFIETTTMMSTTTTRKHRSSSTVQHTSDDIVSS
AECSSDDEDLEECETNNPGGLALPTEPGVRRVPGPSEVVRESSSTTGMVIGIVAAAALCI
LILLYAMYKYRNRDEGSYQVDESRNYITNSAVQSNGAVMKDKQQSSKGSNKKQKNKDKEY
YV
Download sequence
Identical sequences H3CEV5
99883.ENSTNIP00000006779 ENSTNIP00000006779 ENSTNIP00000006779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]