SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006894 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006894
Domain Number 1 Region: 640-837
Classification Level Classification E-value
Superfamily Sec7 domain 9.94e-66
Family Sec7 domain 0.0000113
Further Details:      
 
Domain Number 2 Region: 77-145,356-513,883-992,1047-1158,1479-1595
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000337
Family Armadillo repeat 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006894   Gene: ENSTNIG00000004265   Transcript: ENSTNIT00000007046
Sequence length 1794
Comment pep:novel chromosome:TETRAODON8:Un_random:67883973:67904643:-1 gene:ENSTNIG00000004265 transcript:ENSTNIT00000007046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPPADLADVEPNVFLRPFLEVVRSEDTTGPITGLALTSVNKFLSYGLLDSNHDAAAEAI
ENMADAVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICF
EMRLSELLRKSAEHTLVDMVQLLFSRLPQFKEEAKSYVGANMKKLKMRAGGMSESTKWKK
QKRSPRPPRHLVRSPSAQTDAAAPSTLSNNNLSGGVPFIEQGSSTSSLPASDSAASSISS
PTTTESGLETGSKTTSREDLSDLEQCSPSAVSPNRVAPLPGTEAGSPDAQCEGRHVRSAQ
SASVESIPEVLEDKDSLTEQSDTSSVHDMDYVNPRGVRFTQSTQRDGSSLIPYGLPCLRE
LFRFLISLTNPHDRHNTEAMMHMGLQLLTVALESGHIANYQSLLVLVKDELCRHLFQLLS
VERINLYASSIRLCFLLFESMRIHLKFQLEMYLKKLMDIITSENIKMPYEMKEMALEGLV
QLWRVPSLVTELYINYDCDFYCSSLFEDLTKLLSKNAFPVSGQLYTTHLLSLEALLTVID
SIEAHCQAKVVNGGAHQELLGGEGLSAAKDGADATARAAENSQSLTNGLDPPGGPAGPGQ
PMPEQMRPSRQEPGDGDAAEKRAPQKPQRFSTFIPDSQELLEIRTKKKLLIAGTEQFNQK
PKKGIQFLQEKGLLSSPTDNNQIAQWLRENPRLDKKMIGEYISDRKNAELLDSFVNTFGF
QGLRIDEALRLYLEAFRLPGEAPVIQRLLETFTDNWHKVNGSPFMSNDAGFALAYAIIML
NTDQHNHNVRKQNIPMTVEQFKKNLKGVNGNKDFDQDMLEDIYTAIKSEEIVMPDEQIGL
VKENYVWSVLLHRGATPEGIFLHLPPASCDHDLFSMTWGPTIAALSYVFDKSLDESILQK
AIAGFRKCAMIAAHYGFSDVFDNLIISLCKFTTLSSESVENLPTVFGSNGKAQTAAKAVF
DLAHRHGNILREGWKNIMDSMLQLFRSELLPKAMVEVEDFLEPNGKISLQREETPSNRGE
SAVLSFVTWLSGAEQSGLRGPSTENQEAKQAALLCIKQCDPEKLITESKFLQLESLQELM
KALISVSPDEETYDEEDAAFCLEMLLRIVLENRDRVSCVWQTVRDHLYHLCVHATESCFL
VERAVVGLLRLAIRLLRREDISSQVLLSLRLLLMMKPHVLSRVSREVAYGLHELLKTNAA
NIHCTEDWYTLFSLLESIGAGVKPPASFQLASSTTENDTGAQSDSELSPHHVSEVNVDRG
YTSDSEVYAEHSKARIPRSTTDVDVASSGWLVVGKDDLETSKSFPVSCKGQLEQPLVNQY
SLTLGQDLGQHDTKSLIKCVETLSFIVRDAAHVTPDNFELCVRAIRVFVEASLNGGYRSH
DKKKSHKYDSSKSRLRKKTGGREKEAGGGTRRAGSRRDDEEDEGVPASYHTVSLQVSQDL
LDLMHTLHTRAASIYSSWAEEQRHLEAAGRRIEADSQTLWTSCWCPLLQGIAWLCCDARR
QVRMQALTYLQRALLVHDLQTLDAAEWESCFNKVLFPLLTKLLDNISPADVGGMEETRMR
ACTLLSKVFLQHLSPLLSLPTFAALWLTILDFMDKYMHAGSSDLLNGALPGGAGVPAAGN
WVRVRQLGQVTGSGAVELWEITWERIICFLPHLKEELFKQTVIEPVPSPLAEPVQPTLQP
GPPPSPPPPPPPTQPPPGSPAETKRAESAQEQPGPATADRSDGSSPGPSPLPTLPGPAPS
GQSPLILQPLASPLQVGVPPMSLPIILNPALIEATSPVPLLPAARGACPADQGS
Download sequence
Identical sequences H3CF70
ENSTNIP00000006894 99883.ENSTNIP00000006894 ENSTNIP00000006894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]