SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006950 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006950
Domain Number 1 Region: 1691-1865
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 3.14e-59
Family Sec63 N-terminal domain 0.0000000268
Further Details:      
 
Domain Number 2 Region: 977-1149
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.44e-54
Family Sec63 N-terminal domain 0.00043
Further Details:      
 
Domain Number 3 Region: 1178-1437
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-51
Family Tandem AAA-ATPase domain 0.00098
Further Details:      
 
Domain Number 4 Region: 643-855
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.99e-48
Family Tandem AAA-ATPase domain 0.00085
Further Details:      
 
Domain Number 5 Region: 392-633
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.55e-38
Family Tandem AAA-ATPase domain 0.00033
Further Details:      
 
Domain Number 6 Region: 1866-1978
Classification Level Classification E-value
Superfamily E set domains 2.8e-33
Family Sec63 C-terminal domain-like 0.00000128
Further Details:      
 
Domain Number 7 Region: 1311-1365,1515-1631
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.48e-28
Family Tandem AAA-ATPase domain 0.0019
Further Details:      
 
Domain Number 8 Region: 855-960
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000068
Family Restriction endonuclease FokI, N-terminal (recognition) domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006950   Gene: ENSTNIG00000004320   Transcript: ENSTNIT00000007104
Sequence length 1986
Comment pep:novel chromosome:TETRAODON8:Un_random:30869026:30882517:-1 gene:ENSTNIG00000004320 transcript:ENSTNIT00000007104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTKMGDKAQRTK
PQKLEERRDKRRKRDEDRHDINKMKGFTLLSEGIDDMVGIVYKPKTKETRETYEVLLSFI
HAALGDQVRKFFSSFCLNVQYKMMWASTIYHLIIXSLKCFTNKFFFFVDDNIDETYGVNV
QFESDEEEGDEDLFGEVRDKHSDEDSEGEEANVGCTLTANLGVTGDVMTVKKKDLHPRDI
DAFWLQRQLSRFYDDAIVSQKKADEVLEILKTTSDDRECENQLVLLLGFNNFDFIKILRQ
HRRMIQYCTMLASAQSEAEKERIIGKMESDPELSKILYQLQETEKEDIIREERSRRERVR
KSRVDDLEAMDVDSWRDILQAVAPRQLLDLDDLAFTQGSHFMANKRCQLPDGSFRKQRKG
YEEVHVPALKAKPFAENEALVAIDKLPKYAQAAFEGFKTLNRIQSKLFKTSMDTDENLLI
CAPTGAGKTNVALMAMLREIGKHINMDGTINVDDFKIIYIAPMRSLAQEMVGLSELTGDH
QLCKEEINATQIIVCTPEKWDIITRKGGERTYTQLVRLIIIDEIHLLHDDRGPVLESLVA
RTIRNVELTQEDVRLLGLSATLPNYEDVATCLRVDPAKGLFYFDNSFRPVPLEQTYVGIT
EKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLR
EGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTA
TLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSH
AELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNSKDAVNWLGYTYLYVRMLRNP
TLYGVSHDDRSSDPLLERRRMDLVHTASSVLDKNNLIKYDKRTGSFQVTDLGRIASHFYV
THDSIQTYNQLLKPTLSEIELFRVFSLSSEFRNITVREEEKLELQKLLERVPIPVKESIE
EPSAKINVLLQAYISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLSRGWAQLTDKTMN
LCKMIDKRMWQSMSPLRQFKKLPEEVIKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKT
IHKYVHQFPKLDLAVHLQPITRSTLKVELTITPDFQWDDKIHGSSEAFWILVEDVDSEVI
LHHEYFLLKAKYAQDEHLVTFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPE
KYPPPTELLDLQPLPVTALRNSAFEAVYQNKFPFFNPIQTQVFNAVYNSDDNVFVGAPNG
SGKTICAEFAILRMLLHNAEGRCIYITPMEALAEQVFVDWHQKFQDILNKKVVLLTGETS
TDLKLLGKGDIIVSTPDKWDILSRRWKQRKNVQNVSLFIVDEAHLIGGENGPVLEVICSR
MRYISSQIERPIRIVAQYSMATCDTTSIVINFLRQSIVNGIFVFCVFLVFFCHNHNRFLH
CTEKDLAPFLEKINDSTLKETLANGVGYLHEGLSATERKIVEQLFNSGAVQVVVASRSLC
WGISISAHLVIVMDTQYYNGKIHSYVDYPIYDILQMVGRANRPMQDDEGRCVIMCQGSKK
VVRLLFEYLFVSXSLFFNKNLNSLVYIVLMRCTNFASNICRSIWPLMSGILTQLFICFSE
LFSMSLNAKTKIRGLIEIISNAAEYKNIPIRHHEDTLLRQLAQKVPHKLNNPKFNDPHVK
TNLLLQAHLSRMQLSAELQSDTEEILSKAVRLIQACVDVLSSNGWLSPALAAMELAQMVT
QAMWSKDSYLKQLPFFTSEHIKRCTEKGVESIFDIMEMEDEERTALLQLSDIQMADVARF
CNRYPNIELSYEVADRDSIKSGSPVLVQVQLEREEEVTGPVIAPLFPQKREEGWWVVIGD
PKSNSLISIKRLTLQQKAKVKLDFVAPAMGIHNYTLYFMSDAYMGCDQEYKFSVDVKEAD
SDGDSD
Download sequence
Identical sequences H3CFC6
ENSTNIP00000006950 ENSTNIP00000006950 99883.ENSTNIP00000006950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]