SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006979 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006979
Domain Number 1 Region: 28-209
Classification Level Classification E-value
Superfamily TIMP-like 7.22e-71
Family Tissue inhibitor of metalloproteinases, TIMP 0.000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006979   Gene: ENSTNIG00000002318   Transcript: ENSTNIT00000007133
Sequence length 223
Comment pep:novel chromosome:TETRAODON8:2:200337:203545:-1 gene:ENSTNIG00000002318 transcript:ENSTNIT00000007133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMPLSVHGVFCALVLLVPWRTEELAEACSCAPVHPQQAFCNADVGRVIRAKVVGEQEVNS
GNDIYGNPIKRIQYEVKQVKMFKGPNQDVEAVLTAPVSAVCGVTLDASGRKEYLISGKEE
GGGRVHVTLCDYIMPWEALSAAQKKGLSQRYQMGCECKIVRCPSLPCEVSAPEECLWTDL
VLEKLVYGRQANHYACIKRADRSCSWYRGVSSPKKEFLDGEEP
Download sequence
Identical sequences H3C979
99883.ENSTNIP00000004801 ENSTNIP00000006979 ENSTNIP00000004801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]