SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007101 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007101
Domain Number 1 Region: 1433-1696
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-50
Family YWTD domain 0.00000322
Further Details:      
 
Domain Number 2 Region: 3200-3463
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-50
Family YWTD domain 0.00000254
Further Details:      
 
Domain Number 3 Region: 391-653
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-44
Family YWTD domain 0.00000686
Further Details:      
 
Domain Number 4 Region: 2391-2647
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-44
Family YWTD domain 0.00000509
Further Details:      
 
Domain Number 5 Region: 4056-4325
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-42
Family YWTD domain 0.0000176
Further Details:      
 
Domain Number 6 Region: 708-958
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-40
Family YWTD domain 0.0000227
Further Details:      
 
Domain Number 7 Region: 1743-2000
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-39
Family YWTD domain 0.0000523
Further Details:      
 
Domain Number 8 Region: 2062-2333
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-37
Family YWTD domain 0.000023
Further Details:      
 
Domain Number 9 Region: 262-278,313-382,646-701
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000188
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 10 Region: 2018-2057,2343-2400,2645-2708
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000314
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 11 Region: 2735-2777
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000144
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 12 Region: 1102-1139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 13 Region: 2986-3029
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 1262-1303
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 15 Region: 3627-3666
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000445
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 16 Region: 1061-1098
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 17 Region: 2699-2738
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000103
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 18 Region: 3070-3110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000126
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 19 Region: 1018-1056
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 20 Region: 2858-2896
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 21 Region: 3145-3193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family EGF-type module 0.008
Further Details:      
 
Domain Number 22 Region: 102-143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 23 Region: 27-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 24 Region: 216-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 182-219
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 26 Region: 3585-3629
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 27 Region: 3027-3069
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 28 Region: 1143-1180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 29 Region: 2904-2940
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 30 Region: 3510-3546
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000105
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 31 Region: 3750-3793
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 32 Region: 3793-3834
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 33 Region: 3721-3754
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 34 Region: 3547-3589
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 35 Region: 3112-3159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.033
Further Details:      
 
Domain Number 36 Region: 2814-2860
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 37 Region: 1181-1219
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000089
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 38 Region: 3840-3876
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 39 Region: 3926-3963
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 40 Region: 1387-1426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000298
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 41 Region: 147-179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000107
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 42 Region: 1226-1261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 43 Region: 3882-3920
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 44 Region: 66-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 45 Region: 1307-1343
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 46 Region: 1350-1393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000352
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 47 Region: 2944-2987
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000458
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 48 Region: 3681-3714
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 49 Region: 4007-4039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000217
Family EGF-type module 0.013
Further Details:      
 
Domain Number 50 Region: 2780-2820
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000089
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 51 Region: 3968-4008
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000157
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 52 Region: 4382-4413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000233
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007101
Domain Number - Region: 1699-1742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000597
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 976-1023
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000758
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 3466-3498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00709
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 4328-4412
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.022
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007101   Gene: ENSTNIG00000004460   Transcript: ENSTNIT00000007258
Sequence length 4656
Comment pep:novel chromosome:TETRAODON8:2:13956807:13990144:1 gene:ENSTNIG00000004460 transcript:ENSTNIT00000007258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATMGTAAVPLFLVLMCCVGWGPAEGRGCESGQFRCGTGRCIPGDWRCDGTSDCVDDSDEH
DCPQATCDDSHFRCLSDGECIPDVWVCDDEEDCEDGSDERQQCPGRTCTSNQFSCSNGAC
VPGEYQCDHTEDCSDGSDERSCHYPVCAQLRCASGACYNQTQRCDHIVDCRDGSDEANCS
KHCSAGLFQCHNGMCVPRSYICDHDDDCGDRSDELNCTYPTCKGNYFTCPSGRCIHQVWL
CDGEEDCEDNADEKGCDNVPKECYPGEWPCPSSGLCIPVHQLCDGRAHCPDGEDETNTTA
GRNCSIWKCASLSCEHRCHASPDGGTCSCPSGYVVSSNNSRSCIDFDDCSMWGVCDQLCE
DRTGSHRCSCREGYTLEQHRYCRADPSAGIPSLIFSNGRDLLIGDIHGNNLDTLVNSQNR
GTAVGVDFHYDLRRIFWTDTIQNKVFSVDMDGSNVQVVLNVSVDYPENLAVDWVNNKLYV
VEASVNRIDVVDFDGSNRVTLITENLGNPRGVAVDPTVGYMFFTDWEAINGQPGLERAFM
DGTNRYGIIGTKLGWPSGITLDIEAKRIYWVDSRYDYIETATYDGVHRKTVVHGGAVVPH
PFGISLFEHSVYFTDWTKMAVMRANKFTDSPQVVYNTSQTPHGVAVVHKLKQPHVQNPCG
TNRGGCEHICVLSHQSDNGGLGYRCKCRMGYDLHADGKHCFAVRHFLLFSSQLAVRGIPF
NLSSQEDIILPVTGSPSYFIGVDFSAEDDVIFFSDTAKDMIFKQKVDGTGREVLTANRVD
GVEDLAYDWISKNLYWTDPRYRSISVMKVADKSRRAIVRNLNNPRAIVVHPLIGYIFWTD
WYRPAKIMRAWGDGSHALSIVNTTLGWPNGLAIDWNAMRLYWVDAFFDKIEHSNFDGQNR
ISLDRITQISHPFGLTIFEGYAYYTDWRLGGIVRVRKTDGGEMVIIRRGISHIMHVKSFS
STSQTGFNLCNRLTNPNGDCSHFCFPVPDSQRVCGCPYGMKLLPNQRTCVEDPSNEPPTL
QCGANSFSCGNGKCVPNSYRCDGVDDCHDNSDEVDCGVNNSTCSPTAFTCANTRCVPAAW
RCDGHNDCFDNSDESSCPAPAPGTCPANQFTCSNHRCVPHSWRCDTDNDCGDGSDEADCQ
LGSTCHPGQFQCPDHRCIDPSYVCDGDRDCVDGADERGCIYNCTANEFKCASGHQCINGY
YRCDGVFDCTDRSDERACPTRPPGMCHHESEFQCQSDGTCIPSTWECDGHPDCEDSSDEH
HACPPRTCPSTFFRCDNGNCVLRSWICDGDNDCRDMSDERDCPTPPFRCPSWQWQCPGHS
VCINLTTVCDNTPDCPNGADESPLCNQESCSDNNAGCTHGCIQGPFGAQCTCPVGYQLSN
DSKTCGDVDECSPPGICSQHCFNERGSFRCHCQDGYALEADQRTCKVSDLRQAFLLVASR
NQIVQDDITSQPNVVHSLVRDGRNIVALDFDSVTDRVYWSDTSQDRIWSASNNGSDRTVI
FDSGVTVTESLAVDWVGRNLYWTDYVLETVEVSKLDGTHRTVLVSENVTNPRGLVLDPRS
SAHLMFWTDWGRNPRIERASMDGKLRTVIVNSKLYWPNGLTIDYPNNLLYFADAYLDFID
YCDYNGNNRKQVLASDLVLQHPHAITIFEDFVYWTDRYINRVMRAHKWHGENQTVMLFNL
PQPMGLVAVHPARQPAGGNSCLRSPCSHICLLSAVGPAYYSCACPSGWTLAADQITCTRV
EDPFLVVVRDSIIYGISLNPEDKSNDAMVPVAGLQNGYDVDFDDNEQIIYWVEHPGEIHS
VKSDGTNRTEFAPAAILGSPVGLALDWITQNLYYTNPSTQSIEVLKLRGEVQYRKTLITN
NGSPTGAGSPVGIAVDPARGKLYWTDQGTESGIPAKVASANMDGSNPVNLFTNNLDHIEF
LTVDIRENKLYWAVTSTGAIESGDPDGTNRITIVTGLSHPWGVAVYGSHLYFTDRDFEVI
ERVDKTTGTNRVVLRDNVSGLRVLKVHYRETSAGVSNGCTDNNMGACEQICLPAPQGFFT
CACATGFKLNTDNRTCAPYQSYVVISTLSAIKGFSLEGEDHSEAMVPVAGRGRNALHIDV
HMASGFIYWCDFSSTVAAQNGVRRIKPDGSGLRSIVTSGIGRNGIRGIAVDWAAGNLYFT
NAFLTETYVEVLRLNTTFRRVLLKTQVDMPRHIVVDPRRRYLFWADYGQHPKIERALLDG
TNRTILVSSGIVTPRGLALDWQSGYVYWVDDSLDMIARVSPQGGETEVVRYGSRYPTPYG
ITVFENSIIWVDRNLKKVFRASKEPGSTEQPTVIRDNINMLRDVTIFDRHTQPTTAQELN
FNPCVEENGGCAHFCFALPEYGSDGQNKVCSCAFGNLGADNKGCVVSRDDYLIYTTESTV
RSLRLDPDDHALPFPVVNVPRTSVALDFDLTERRIYFTQSSGAGASKISYVSLSAPTSTP
VVVAFDLGAPDGIAYDWINRRIYYSDFVNQSINSMSVEGSQRTVVVHVSRPRAIMLDPCR
GYMYWTDWGTHAKIERATLGGNFRTDIVNSSLVWPNGLTLDYEDERLYWADASLQKIERS
SLTGSDREVIVSTAIYPFAMTMFDQFIYWTDWNTRSIYRANKHDGSGQRVMIQNLPSRPM
DIHVLASRKQQQCDSPCQQFNGGCSHICTPGPNGAECHCPSEGRWYLADSKHCIPDNGTR
CQPGQFTCMNGHCIRAQWKCDNENDCGDGSDELERVCAFHTCEPTVFTCGNGRCVPYHYR
CDHYDDCGDNSDELGCLFRPCDPSREFTCNNGRCIAKDYVCNGINNCYDNGTSDEQNCPE
RTCQPEQTKCQSTNICIPRSYLCDGDNDCGDMSDESPTHCVASTCSQSEFRCSSGRCIPA
RWYCDGGADCSDSSDEPLSCTPQVRTCNTEQFRCDDGRCIASTWICDGDNDCGDMSDEDQ
RHNCANRTCSNAEFTCVNNQPPQRKCIPRDWVCDGDADCADALDEHQNCTRRSCGVNEFT
CSNGLCIRSSYRCDRRNDCGDGSDEQGCTYQACQQHQFTCQNGRCISRDFVCDGDNDCGD
ESDELEHMCHTPAPTCPPGEFRCDNGHCISLSRVCDRNDDCSDNSDEKGCGVNECTDPSI
HHCDHSCTDTPTSFICTCRPGYRLMSDGKTCDDVNECAETPRVCSQVCENTVGSYVCKCA
PGFLREPDGHSCRQNSDIAPYLIFSNRYYLRNLSTDGAAYSLILQGLTSVVALDFDRVDR
RLYWIDVSRRVIERMSYNGSNREVVVTGVLHGEGLAVDWIARKLYWVDSFSDCLKVSELD
GRFVKKLAEHCVDANNTFCFENPRAIVLHPKYGFVYWTDWGDKAFIGRVGMDGTNKAPII
TTKLEWPNGITIDYTNDKLYWSDAHLSYIEFSDLDGQHRHTVYDGNLPHPFALTVFEDTV
YWTDWNTRTVEKGNKYDGSGRQALVNTTHRPFDIHVCHPYRQPIVTNPCAVNNGGCSHLC
LIRHGGQEHTCECPDHFLTIQIGGVTRCLPMCTSTQYRCANNERCIPIWWKCDGQRDCRD
GSDEPSTCPVRHCRLGQFQCNDGNCTSPHLLCNSHQDCHDGSDEDPVLCATHQCENHQWQ
CANKRCIPESWQCDGEDDCGDQSDEDPAHCSSRTCRPGQFKCRNGRCIPQSWKCDVDNDC
GDNSDEPLEECMGPAYRCDNHTEFSCRTNYRCVPMWSVCNGHNDCRDDSDEQGCDELTCD
PTGDFRCNNHRCIPLRWRCDGDDDCGDNSDERSCTPRTCTESEYRCDNLRCIPNRWVCDH
DNDCEDNSDERDCELRTCHPGYFQCTSGHCISERFKCDGNPDCLDYTDETSCPTRFPNGT
YCPPFMFECKNHVCVQPHWKCDGDDDCGDNSDEELHLCIDIQCETPFRFRCDNNRCIYSH
ELCNSVNDCGDGSDEIPENCPNPTHGPCTDEEYKCSNGHCIPLPYACDDYDDCGDQSDEL
GCHRGSTHTCSDNICEHNCTDLREGGLLCSCRPGYKPRATEKHMCEDVNECEVYGTCPQE
CKNTKGSFECFCAKGFVSIGEPHGTECAAQGNPPVLLLPDNVRIRRFNLSSQQYSDYVDN
AEHIQALDYLWDPEGQGLSVVYWTVLGRGSEFGSIKCAYMPTFNDYGSNPVKEVDLNLRY
VSKPDGIALDWVGRHIYWTDSGTNRIEVAKLDGRYRKWLIHTDLDQPAAIAVNPLLRMMY
WTDWGRKPRIETAWMDGQNRAVLVDEDLGWPTGLTVDYLNGNRIYWCDSKENTVESMKPD
GTDRKAVISGDIGHPYSLDVFEGHLYWTTKDTGEVWRTNKFGNGHKVKVLTINPWLTQVR
VYQEHRHNQTVPNPCKNVCSHLCLLRPGGYTCACPQGSSFAESDFGICDAAIEPPVTMPP
ACRCMNGGTCYTDEGGMPKCKCPYGYTGSYCDMGKIINAPAGTGASVAVLLAAIIIIITG
ALAAGVFLNYKRTGSFIPSMPKLPSLSSLVKSADTGNGVTFHSGDNVDLGPSHIGVSFID
TAMQMDNNFAMEVGRQPITFENPLYATAPAALILVQKVTVNTSGEHLENNFVNPTYSGDQ
RVSIITTSSSSSKPVQESKWSLFMRKLKPGTTFQNPSYAEMKDEKPAEGGRDWSAPEPPP
FVPPSKPQKRDRPSTFSPTEDSFKDTATLVKEDMDV
Download sequence
Identical sequences H3CFS4
ENSTNIP00000007101 ENSTNIP00000007101 99883.ENSTNIP00000007101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]