SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007289 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007289
Domain Number 1 Region: 148-281
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-25
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily Sec7 domain 3.53e-22
Family Sec7 domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007289   Gene: ENSTNIG00000004638   Transcript: ENSTNIT00000007447
Sequence length 295
Comment pep:novel chromosome:TETRAODON8:1:9830435:9834847:-1 gene:ENSTNIG00000004638 transcript:ENSTNIT00000007447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNFLKAFPLMGETQERERVLAHFSKRFCHCNPQIPTFEDGAHTLTCALMLLNTDLHGHVC
TGVLYLSCCFLLINEVNVKFLSLLLQVLYNSIKNEKLEWAVEEEELRKSLSELVEEQCEG
GSKRVARVTDGSNPFIAIPILLNAVTYKHGGVNRKSHADMDGKRTPRGRRGWKKFYAVLK
GIILFLQKDEYKPDADISEVDVKNAIRIHHALATRATDYTKRANVLKLKTSDWRVFLLQA
SSEEEMMSWIFRINLVAALFSAPAFPAAIGSMKKFCRPILPSSSTRLSQVHPQKS
Download sequence
Identical sequences H3CGB2
ENSTNIP00000007289 99883.ENSTNIP00000007289 ENSTNIP00000007289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]