SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007319 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007319
Domain Number 1 Region: 674-850
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-38
Family MAM domain 0.0005
Further Details:      
 
Domain Number 2 Region: 170-267
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000839
Family I set domains 0.0078
Further Details:      
 
Domain Number 3 Region: 276-355
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000418
Family I set domains 0.076
Further Details:      
 
Domain Number 4 Region: 372-448
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000662
Family I set domains 0.021
Further Details:      
 
Domain Number 5 Region: 470-557
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000396
Family I set domains 0.051
Further Details:      
 
Domain Number 6 Region: 523-662
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000033
Family Fibronectin type III 0.006
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007319
Domain Number - Region: 18-59
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000138
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007319   Gene: ENSTNIG00000004666   Transcript: ENSTNIT00000007477
Sequence length 854
Comment pep:novel chromosome:TETRAODON8:5:2815073:2864134:-1 gene:ENSTNIG00000004666 transcript:ENSTNIT00000007477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVRWTKTAGSASDKFQETSIYNETLRIEGIQRVQGGRYYCKADNGVGVAAIKSIRVDVQC
LIDPSVILNSLGGSFSNPKKKKKSISLYIFLGNEPPFAMTCMQMKNVLQQTLSEPARDYD
VSFSLIELNVLFISNILTCGVAVLALEYCTKPPCNLPNSPMRFDEDNTKAPPMIRLSVND
TVVVDPGQDVLLNCEIIAGFPAPAVTWSRYPGPLPLSAQVRGPVLFLRAVTPADSGFYNC
TAVNNVGNPARKNVNLVVRTMTNLTFQITPDSNKDSETIQMHRDLKLSCHVDATPQDKVN
YSWYKNGAPIFGSGRLIILRSDPDMAPGTSSLEILDMKFQDLATYSCVANFPGSRVPELR
VDVNISQNSVSPPVLSVPPGGQMISVREGANAELACLVTAKPRPPVLWSRAEKLLMPGGR
SITETPDGRLRLRNVSRDMMGAYRCQTAPYNGLNIKRRGGTGVLLITSNPPTLDPVFQDV
RSRNYQMVTLRCAVLRSNPPRLTDIRWFRNGEFIRMPVPDLKETPELKFKLEPTNNGSYE
CRVSNSIGMSTCMFNVSTKPYYAEFYFDTPNPVRIQKGNNYSYNLQWTQRDPEATDRIIG
YWLMVRKVFQNKQNVFAKQIDLRGKEPEKGVLMSHTISDLRIPLAYEVRLAPITTYSTGD
YISRTIQYSERVLDHVCGFEDERICGFSQDRSDDFDWTRQNHLTQNPKRSANTGPETDRS
GTKEGYYMYIEASRPRVQGDKARLLSPLFNVTSVRGPKGSGRVPYCVSFYYHMKGKHIEN
VFEKHLTVRSIASVDSVVWTKSGHQGPDWKRALFDVSPSGPFQIVFEGIRGPSFEGDIAI
DDVSITIGKCKQEN
Download sequence
Identical sequences H3CGE1
ENSTNIP00000007319 ENSTNIP00000007319 99883.ENSTNIP00000007319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]