SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007347 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007347
Domain Number 1 Region: 205-325
Classification Level Classification E-value
Superfamily Cap-Gly domain 5.11e-33
Family Cap-Gly domain 0.0000055
Further Details:      
 
Domain Number 2 Region: 79-163
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.14e-30
Family Cap-Gly domain 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007347   Gene: ENSTNIG00000004694   Transcript: ENSTNIT00000007505
Sequence length 999
Comment pep:novel chromosome:TETRAODON8:Un_random:27175944:27183146:1 gene:ENSTNIG00000004694 transcript:ENSTNIT00000007505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKSSGLKIPGRGPKHASPMGRTPGGTSSPAPKDSKDPAHLGGPLRGDNLWAGPASRNVA
DVAAEKPTTPTKLSEEGDDLLGDLAVGEQVWVNGVKPGVVAYLGETQFAPGQWAGVILND
LRGKNDGSVGGVRYFECQPLQGIFTRPSKLTRQPLGEGSDAPSAESLPGQNQAQVVPLRE
GLLNSAVKTGNESGSNMSDSGSVKKGGDKDLRVGDRVLVGGSKMGVIRYMGETDFAKGEW
CGVELDEPLGKNDGAVAGTRYARAYFQCLPKFGLFAPVHKVLRIGFPSTSPAKAKKSKRV
AMGVSSLAHSPSSSSISSVSSVASSVSGRPSRAGLLTETSSRYARKISGTTALQEALKEK
QQHIEQLLAERDLERAEMAKATSRIAEVEKDLGLLKTQHLQYVSEQENHLLQARGLLASA
QKDKQELANQLEEEKRKVEDLQFRVEEECITKGDLEEAAPAEVWRRRLGDVVLTGAVRSA
CANRTQVLMGLVPRAQTTVEEQSRIAGLEEELRLRRAEVEDLQARLGGGAHPESGQKQEA
ESLRAAVDSKNQEISEMKQKLQQASEEKVEMMDAWKTKLDALVSDHQRSMEELKVALSSG
PEGPAGQEPDAPELRATLEALKMEHQLEMENLKAKHEIQAALLTKEREDLSARLQELQEP
QEQRSARPASRGGPTQRPGASRAWRSSAGSCRRRSEGWRRWSGRRRSCSRSCSSPRRRRP
TTRGGARRRSRSCRSSVRATANRLQAAQADRHAPQDAEVIQEPEEEEEKMKLKQSVDETM
EKLQKREKEVSALASQVQGLQAQLTVLEGKVRSGREEGRPSGQGEDARGGGLESMSRKSQ
DASGQLVHISQELLKKERSLNELRVLVMESQRHSRDLEKDLARDVHKAEWTLKEQKLEDD
IRTLRHRDCCWDRERSSPDHRRYSMLEPSALDSEMSRLRQRLLSTEDALRNALEHNQQVD
RLVQAMRRHPEKSPVRGTSSANGIHHQEADGPREENQKN
Download sequence
Identical sequences H3CGG9
ENSTNIP00000007347 ENSTNIP00000007347 99883.ENSTNIP00000007347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]