SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007400 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007400
Domain Number 1 Region: 221-424
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.13e-45
Family Reprolysin-like 0.0023
Further Details:      
 
Domain Number 2 Region: 515-571
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000249
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 867-930
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000523
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 933-983
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000798
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 809-868
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000017
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007400   Gene: ENSTNIG00000004746   Transcript: ENSTNIT00000007558
Sequence length 1170
Comment pep:novel chromosome:TETRAODON8:1:671008:736126:1 gene:ENSTNIG00000004746 transcript:ENSTNIT00000007558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVRPISVDAEGRFLSHAVSAGRVVGGQPRRRRRRDVGIGPDEWEEPKAEHVADREKLYYN
VTIFGREFHLRLRHNTRLVAPGAKMEWHDDSDSTRRTEPLHDACLYVGDITDTPGATVAI
SNCDGLAGMIRMEQEEFFIEPVERGAGVIEEKEQEGGGGRTHIVYRSSAVKKNSPVHSPH
ALCAGADLGAMMDLESLHRGVEQSINHTRAGRMRRQSLERSYNIEVLLGVDDSVVQFHGK
EHVQKYLLTLMNIVNEIYHDQSLGAKINVVLVRIIMLGYGKSMSLIELGNPSQSLENVCR
WAFLQQKQDTGDAEYHDHAIFLTRQEFGPTGMQGYAPVTGMCHPVRSCTLNHEDGFSSAF
VVAHETGHVLGMEHDGQGNRCGDEVHMGSIMAPLVQAAFHRFHWSRCSMQELGRYLHSYD
CLRDDPFDHNWPSLPQLPGLHYSMNEQCRFDFGVGYTMCTAYRTFDPCKQLWCSHPDNPF
FCKTKKGPPIDGTMCGNGKHCFKGHCIWLTPDIIKQDGNWGAWSEFGQCSRTCGGGVKFR
TRNCDNPRPANGGRTCVGATYQFQMCNTNECEDIYNDPREEQCRTWEPDFELHSNKHHWL
PYEHPDPNKRCNLHCQSKETRAVALTDRVVLDGTRCSYKDPHSVCVRGECEKVGCDGVFG
SSKQEDKCGVCGGDNSSCKTFKDTITRTSKKQGCLKVIEIPRGARHLLIQELKATSHTLA
VKNVASGLFFVNGENEYPESHSVIEKGVEWEYEYDNGKETLQTSGPLRHGILIMMKLHGD
EDVNLSYKYMMNMDSDTAIQNNMLVEDSSYEWAPKKWSYCSRPCSGGKQYLRYGCRRKVD
SKMVHKSFCNKSNMKPRGDVRDCNQKPCPPPVWVTGEWQNCSKTCGKTGTQIRTVSCMQP
SEDNTTRSIHNKHCNDHRPESRRACNRHPCPTQWRVGPWTQCSVTCGNGTQQRKALCHTR
DNTIGLCLDSKPDTIRVCRLDPCPKGSSDLNKNGNILIQWLSRPNPYPKISSRQRCTGDR
SSFCRIEALKRHCSLPDFRRMCCQSCGGVTNSSGGFVPIRPRVTSPPTSTSSINYFLPSS
FKPEVTTELFPSTIPSTGVPLTTVTTGSTKDPTTRARTPLWNTGVDGDVPQNNQIPKRRV
NFRERTKNKRIQELLEEKRNFLLRKKRGHA
Download sequence
Identical sequences H3CGM2
99883.ENSTNIP00000007400 ENSTNIP00000007400 ENSTNIP00000007400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]