SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007530 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007530
Domain Number 1 Region: 52-197
Classification Level Classification E-value
Superfamily C-type lectin-like 8.05e-32
Family C-type lectin domain 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007530   Gene: ENSTNIG00000004867   Transcript: ENSTNIT00000007690
Sequence length 198
Comment pep:novel chromosome:TETRAODON8:21_random:3116450:3117895:1 gene:ENSTNIG00000004867 transcript:ENSTNIT00000007690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRGVCVLLGVLLLVDCSVQQSPPKRKPLKKAEKQKDPAMEQMQKQINDIVQELNLLKE
QQALQAVCLKGMKIHRKCYLVDPVRKSYHAASEDCSNLGGVLGTPTSSNENDQLRDYLRQ
SVNPGEQVWLGVSDMVKEGAWVDITSTNITYKNWDTSNGQPDGGRSQNCAVLSGASNGKW
LDENCKEEKASVCQFNIV
Download sequence
Identical sequences H3CH02
ENSTNIP00000007530 ENSTNIP00000007530 99883.ENSTNIP00000007530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]