SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007815 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007815
Domain Number 1 Region: 160-262
Classification Level Classification E-value
Superfamily TAFH domain-like 6.41e-32
Family TAFH domain-like 0.0000533
Further Details:      
 
Domain Number 2 Region: 447-496
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000586
Family TBP-associated factors, TAFs 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007815   Gene: ENSTNIG00000005146   Transcript: ENSTNIT00000007976
Sequence length 645
Comment pep:novel chromosome:TETRAODON8:Un_random:75010660:75015044:1 gene:ENSTNIG00000005146 transcript:ENSTNIT00000007976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSGAPHTLAVAPQLPPSAPPQPANIQIPPGMILIRSESGQLMLVSQQALTQTQQGPARVG
SPMPRITASLAAKSTEKLRVAPPGLPSLQPAPAYKSVVKVAAASKPRGLQAHVSCRPLSV
TQRGGPGSSVGNQPGLQTTVPGTAKEPPATFSLADSEETLESVKKCKNFLVTLIKLASSD
PQAGSMATNVRGLVRALLEGKVEAEEFTEQLYQELKSTPQPCLVPFLKKSLPAVRHLTAD
PQVFIQQACVSLHHHRSASTVKQPNPDKNISPEGQKVSRATGCSSFSSFLLWWAQRSWPD
RTQHVCIQRERQVFGTCFECSLATQEPGGAALRPRPASSLLSNSTAKSCRPDCKVPAAPS
GRHLTGEPVEMSEPRPPVAPHQEYWWILLRRSVMHLKTFVEPTMCSPREDDDINDVASMA
GVNLREENAQILTTLVGSVVQSCQDQLFLSPHLLLSRILHAGQPQGVSDVAPEAVALVSH
ATQERLHGLLLKLSVMAGHRKAAVKEDPRHTRVSDVRSQLRFLEEVETLKKKRKDEEERE
RLLRLARSRSHSEDPQQQQLKQRAKELQQMEEAQLQHREANLTALAAIGPRKKRAPEQPE
SQRQVAVLPRPGLPQLTRVSLRDLLLVMELEPPLSRSLLLYRAML
Download sequence
Identical sequences H3CHT7
ENSTNIP00000007815 ENSTNIP00000007815 99883.ENSTNIP00000007815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]