SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007852 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007852
Domain Number 1 Region: 26-219,300-456
Classification Level Classification E-value
Superfamily L domain-like 1.55e-58
Family Ngr ectodomain-like 0.0005
Further Details:      
 
Domain Number 2 Region: 1139-1350
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-39
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 3 Region: 515-713
Classification Level Classification E-value
Superfamily L domain-like 1.46e-34
Family Ngr ectodomain-like 0.0004
Further Details:      
 
Domain Number 4 Region: 990-1031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000645
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 5 Region: 953-998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000237
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 6 Region: 1019-1153
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000455
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 725-900
Classification Level Classification E-value
Superfamily L domain-like 0.0000282
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 8 Region: 1431-1467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000434
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1390-1426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000949
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007852
Domain Number - Region: 1348-1389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00173
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007852   Gene: ENSTNIG00000005179   Transcript: ENSTNIT00000008013
Sequence length 1551
Comment pep:novel chromosome:TETRAODON8:18:184430:246626:1 gene:ENSTNIG00000005179 transcript:ENSTNIT00000008013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGPGRSRAAALRLLVSFLVLVLVLLSGVYGQPCPTQCSCTGTTVDCHGQGLRSVPRNIPR
NTERLQCAGKNANNLTKIAKADFAGLRHLRVLQLMENKITTIERGAFQDLKELERLRLNR
NNLAVFPELLFLGTTKLSRLDLSENQIQGVPRKAFRGAVEIKNLQLDYNHISCIEDGAFR
ALRDLEVLTLNNNNISRLSVASFNHMPKLRTFRLHSNNLQCDCHVAWLSEWLRQRPRLGL
YTQCMAPPHLRGHNVAEVQKKEFVCTGHHSSSSSACSVLQCPESCTCSNNIVDCRGKGLT
EIPTNLPETITEIRLEQNAIKVIPAGAFSPYKKLRRIDLSNNQISELASDAFQGLRSLNS
LVLYGNKITEISKGLFEGLFSLQLLLLNANKIACLRVDAFQDLHNLNLLSLYDNKLQTIA
KGTFSSLRAIQTLHLAQNPFICDCHLKWLADYLQDNPIETSGARCTSPRRLANKRIGQIK
SKKFRCSGTEDYRSKLGGDCFADLACPEKCRCEGTTVDCSNQKLTKIPDHIPQYTAELRL
NNNEFTVLEATGIFKKLPHLRKINLSNNRITDIEEGTFEGASGVNELILTSNRLENIHHR
MLKGLGGLRTLCMLRSNKISCVSNSSFVGLSSVRLLSLYDNQITSVNPGAFTLHSLSTLN
LLANPFNCNCHLAWLGDWLRRKRIVTGNPRCQNPYFLKEIPIQDVAVQDFACDDGNDENS
CSPVLRCPAECSCLDTVVRCSNKGLTALPKGLPKETTELYLDGNHFTQVLRNSPIYKHLT
LIQAAKLTVVYRKNPLCVQMSHLSPRLKFKYLGKFNHPSFLVATLNKYSKKKKRNLLFQR
ETILTVSALGANPLHCDCHMQWLSDWVKSGYKEPGIARCTGPGDMADKLLLTTPSKKFTC
TVFHPLHLGTFFVCRPCQESADESFSLTNHKRGENITLSRSYSKYLIXCEEPIHACISNP
CQNGGTCHLKEGESSNFWCVCPEGFEGDKCEINIDDCEDNDCENNSTCVDGINNYTCMCS
PEYTGELCEEKLDFCAPELNPCQHDSKCILTPQGYKCECPPGYVGEHCQLDHNDCEDNKC
HNGAQCIDALNGYTCVCPEGYSGLFCEFSPPMVLPRTSPCDNHECLNGAQCVVTGSDPRC
QCLHGYEGEHCETLVSVNFMNRASYLQLPSNLLSPETNISLQIATDEDSGVLLYKGDDDH
IAMELYRGRLRVSYDTGSYPPSAIYSVETVNDGSFHAVELVASDQTLSLSIDGGAPKSIN
SLSKQSTLNLDSPIYLGGMPERAPALGGLSSLQHSSGGRNGTGFHGCLRNLYINGKLQDL
AAGLRPGTFGPATAQSTTRQWLGQGVEPGCQPCQRASCLQGDCHPTGHRGFSCTCHPGWT
GPLCDQQVNNPCDGNKCVHGTCLPINSYSYSCRCQPGHSGVLCDEQDQEATNPCSLSQCK
HGKCRVSGLGKAYCECNSGYTGETCEREVACRGERVRDFYQRQQGYAACQTEEKVSRLEC
RGSCPGGAAGQGTCCTPLRSKRRKYTFQCTDGSSFVQEVEKVVKCGCTKCS
Download sequence
Identical sequences H3CHX4
ENSTNIP00000007852 99883.ENSTNIP00000007852 ENSTNIP00000007852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]