SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007943 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007943
Domain Number 1 Region: 896-1076
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-23
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 1083-1251
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.24e-22
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 3 Region: 684-870
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-16
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 4 Region: 50-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000753
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007943
Domain Number - Region: 431-601
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.0157
Family Chemotaxis phosphatase CheZ 0.014
Further Details:      
 
Domain Number - Region: 123-179
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0497
Family MukF C-terminal domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007943   Gene: ENSTNIG00000005264   Transcript: ENSTNIT00000008104
Sequence length 1263
Comment pep:novel chromosome:TETRAODON8:Un_random:76527437:76539564:1 gene:ENSTNIG00000005264 transcript:ENSTNIT00000008104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPCNCKGHSDSCDDITGICRNYLNNLPKFITYLQYEGYFGFSSCQGCRRCECGPASTRPT
CHPLTQSCLCRPGVGGRYCERCLPGYWDYSPAGCQRCDCESGHCDMQTGECLLEAQTVSL
CNNSCDECIWHLMGDLKQSNKTLDQLKVGVLNISTGAAANDRLKYYNYTAHRLQIQFDSW
RGKSSVLKNQTEQLKEASKAIALDILQLEESEDVVKTLGNTLDNRTLETVTKAEQLDTDL
SELNVLIEEMIQDWELYRDNQDVDPEVVRKSTEVAQGMVAWMRKMDLSPREPIATDESSE
AHDLLRRVRQLEKKLMNTDSRLPPVKEILSRFNAKLSDAQGFLQNATTAIQQTTDQNTAN
SFKFQRHEAKQQRLLEDYASINETLDVAKGLISGTDVIVADMDALVQNISGYHAAVDGAS
LKLREKSERLSLADRDLVQRADNHAEDLDRQANELEEDLKESDADGFVQRAISAANVYNN
IVKYTDDANITSLTTLNKSERAEEAVAEINTQLEQLVTQSDHVFKESVSLHSEQNEVENE
MTDKLKYIEETKEAIDKHSNILSEIKASMNEIFADRTPQRLEFTLEVAEGTLNRSAEVLQ
TITPISKKVEKWANNMRNNEYSTEAYKEAILSAGEAVENLNVLVPELLDKLKVVEEKKPV
NNVSSNIMRIRELISQARSVAKKVQVSMKFNGQSSVEVHPPSNLEELMSMTSISLFMRVD
PDKDPIEDRFILYLGDRNGQKDYMGLAIKNDNLVFVYNLKGEDVEIPLSSKPVSQWPAVF
NYIKVERLGRHGKVFLTIPSQSSTDEQKFIQKGEAPGTDSLFDLDPEDIVFFVGGFPPDM
KLPPPLSLAPFVGCIELSSLNADIISLYNFKKIHKMDLATSTPCPRYKLAFSQARITSYL
FDGSGYALISNIERRGKFGVVTRFDIAVRTVANDGILFYMVNGDKYFLLEIKNGFLRLMY
DFGFTNGPQLLENNLPKLQISDARYHEVSVIYHQSKKVILLVDKSHVKSLENPKTTLPFS
DIYIGGAPSNILKSRAELAGAVGLKGCVKGFQFQKKDFNLLEEPGTIGISSGCPEESFMS
RKAVFSGDGYLGSIAKFSPFNNFEGGLSFRTLLPSGLLFYHNEGAEEFAISLENGAVVLN
CRGTRVKSHKKQYNDGRAHFLVAVVSGQKYSLLVDDKDKQEKKRPTSTARAPSGPALKNF
YFGGSPSSSHKNFTGCISSAYINRQDRDIEPEDFQRYTEKVQISLQGCPLQQRPLTPLLL
SQK
Download sequence
Identical sequences H3CI65
ENSTNIP00000007943 99883.ENSTNIP00000007943 ENSTNIP00000007943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]