SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008003 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008003
Domain Number 1 Region: 26-474
Classification Level Classification E-value
Superfamily Sema domain 5.62e-101
Family Sema domain 0.00042
Further Details:      
 
Domain Number 2 Region: 1338-1468,1643-1800
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-41
Family p120GAP domain-like 0.01
Further Details:      
 
Domain Number 3 Region: 823-927
Classification Level Classification E-value
Superfamily E set domains 0.000000000000392
Family Other IPT/TIG domains 0.0062
Further Details:      
 
Domain Number 4 Region: 924-988
Classification Level Classification E-value
Superfamily E set domains 0.0000000000106
Family Other IPT/TIG domains 0.073
Further Details:      
 
Domain Number 5 Region: 477-526
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000244
Family Plexin repeat 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008003
Domain Number - Region: 1015-1056
Classification Level Classification E-value
Superfamily E set domains 0.000407
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.035
Further Details:      
 
Domain Number - Region: 1491-1584
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0277
Family Ubiquitin-related 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008003   Gene: ENSTNIG00000005320   Transcript: ENSTNIT00000008165
Sequence length 1862
Comment pep:novel chromosome:TETRAODON8:19:503667:514286:1 gene:ENSTNIG00000005320 transcript:ENSTNIT00000008165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWCWWWAWLSLALTTTCCRPTEAKAPEFVSATLINNVVADPQTGLLYVGAVNSLHQLSP
DLQVLSRSETGPKRDNRLCTPPVTEACEEAVDTDNHNKLLLVHRAQNALVVCGSVFRGIC
SLRNLSRVEEVIYYSDTKGEKSYVASTEEGVSVVGVMSYYQKGGEDLAVFLVGKGYGSQD
STKLISTRILQDYGDWVVFDNIIEAAAVQSNPFVLRYLHNFRFAFKDRSYVYFLFSRTLG
AQDTKNFTFIARLCENDHGYYSYTELQLNCSTGNKHNKAQVNASSSAFTAPWSARVLFVT
FTSDDEPSSSAMFGPGMFPLRSINRRLMEMLEACYSGNGVINGKPGVYLPYSSKPDDCQS
HQQKNMLESNKCGAEFLPSPLASRAEAALTAEPLLVRKAELTAVAVSVEMEHTVAFVGTA
SGEVLKVHLSARPEVYGRASAELTRDKVNKNLLLDPSGRHLYITRERRITKVPVQTCHLK
TDCQSCMALKDPYCGWCVLEGRCTRKQDCSRSSEEKAWLWSPHQKCVSRSSPSPRRHLSC
KPRSRRAVWEVDIVIPAHPRLRRTDRLQCWFGNTSSGALFDGQTLVTCSLPDPVEIPHTE
GQQADYVSVPVKVLVNESIEVTSGEYRFYNCAATVRKNQNAPCISCVTSEWGCQWNIEDH
SCSDRRSGGSQATVRTKDQPDRCPRFESPKPLLIPVGFGIPIRFQGRNLDVYWKQGSTFT
IGTELMKSTETDVVQKDSEFTFTGYKFSYDKHQEVNISFHLKEKDTDRKIDSTLSVGLYN
CSVGREDCSLCQHADATYQCVWCAAKRSCVYRELCGSSAPAQCPEPKITAISPRQGPLNG
RILVTIKGSNMGVRKEDIKRITVAGVDCVHQEDRYSVSTSVVCEIGPAKRVPPSDVPFEP
THAGVVEVLVEGGRSGMSEFNFTYRDPEPTAVEPARGPAAGGTVITIKGKYLNTASKEDI
SITVGGVPCPVLSFGDVITCTTGRYSEQKLPSDPMAVRVNYGRDTTKEVASAFQYCENPK
VSEYSPKASFVCGGRKIKVVGNGFDLIQRATMRVLPSTDEFSENTAPAELCSLCPTQFVQ
EGKKENDTVLHFDSPVVNGSCDVRSLRTFLHLDNVVEELKSFVYHPEPTFDKLQKNVITE
TSIIIVTGRGFDKAMTVPEAKAFVGDAPCHVNILQGDKLILEAPAQQRRDTANEMLELVV
KFGQCERLVDSVYYARKEGIPLAIIIPVVILPMLLFIGVSVYCYRRKSQQAEREYEKVKH
QLENLEESVRDRCKKEFTDLMIEMEDHTNDLSEARIPFLDYKSYTDRNFFLSSKDGANDA
MITGKLQIPEGRRAIVAQALNQFSNLLNSKTFLINFSSFTTLESRPDFNARSRGYFASLL
TVALHGKLEYYTDIMRTLLLELMDEHVQNKNPKLMLRRSETVVDRMLYNWMSMCLYQFLR
DTAGEPLYKLFKALKHQVEKGPVDAKMKKAKYTLNDTGLLGDDVEYSVLTLQVLVHGEGP
DVTPVKVLNCDTITQVKEKVIDQVYRNMPYSQRPKVECVALEWRPGSTGQILSDLDLTSQ
KEGRWKKLNTLAHYNVRDNATLVLSTVLHTQSFYQHQDSYEERNSLLEEDNTFHLVRPAD
DMDEVKSKRGSMKDKAMTKAITEIYLTRLLSVKGTLQQFVDDFFRSVLCSNSVVPPAVKY
FFDFLDEQALKHDNVDEETLHIWKTNSLPLRFWVNILKNPHFIFDVHVTEVVEASLYVIS
QTLMDACTKTEHKLSRESPSNKLLYAKEISSYKKMVDDYCKGIRQMVSVSDQDMNTHLAE
LSRQHTDKLHTQGALHQLYQYASKYYDVIIQSLDEDPAAQNKQLTLRLQQIAAALENKVT
DL
Download sequence
Identical sequences H3CIC5
ENSTNIP00000008003 ENSTNIP00000008003 99883.ENSTNIP00000008003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]