SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008029 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008029
Domain Number 1 Region: 380-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000111
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 2 Region: 304-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000963
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 3 Region: 376-496
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000204
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 4 Region: 263-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000676
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 5 Region: 342-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008029
Domain Number - Region: 232-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0488
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008029   Gene: ENSTNIG00000005347   Transcript: ENSTNIT00000008192
Sequence length 709
Comment pep:novel chromosome:TETRAODON8:5:3691056:3695088:-1 gene:ENSTNIG00000005347 transcript:ENSTNIT00000008192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLALLLLLTLALLTCQVVCSGVFELKLQEFLNKKGLSGNANCCPGGAAHPHQHCECKT
FFRICLKHYQANVSPEPPCTYGGAVTPVLGSNSFQVPETNADSFTNPVRFQFGFTWPVSD
NRHLDWPSGGPVLLPQRLLIGQAGGQLLCERRQWSSCLVVDGEEMKESSEISRGRGGSRF
RRPNHISPFTCPSFVHLAAICLPGCDEQHGFCDKPGECKCRVGFSGRYCDDCIRYPGCLH
GTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCLNGATCTNTGQGSYTCSCLPGFTGASC
EIQVNECSGNPCRNGGSCTDNENGYKCTCPPGFYGNNCELSANTCADGPCFNGGRCADNP
EGGYFCQCPVGYAGFNCDKKIDHCSSNPCLNGAECVDLVNSYLCQCPDGFSGPDCGESSS
ISGFCLSFPCQNGGTCQEGANGYTCTCPPGYTGENCSSPVSRCHHNPCHNGATCHERGGR
YVCACVPGYGGHNCQFLLPEVPKGQPVVDGPDRRYSSPESRNIEDEEEDESRFPWTAVCA
GVFLVLVILIGCSVLVVYVRVKVQFNSSQRGDSAHGDSHETMNNLTTANNCLRGDKELGT
MMTTSVKNTNKKADYHSDLEKNGFKSRYPSVEYNLVHELRPEELAPCKEERDQPQAKGEM
PDHSDSEEEYRRRKHSPSDSKYQCTTDTIYQSVYVMSDQKDECIIATEV
Download sequence
Identical sequences H3CIF1
99883.ENSTNIP00000008029 ENSTNIP00000008029 ENSTNIP00000008029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]