SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008192 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008192
Domain Number 1 Region: 339-522
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-66
Family SPRY domain 0.00000823
Further Details:      
 
Domain Number 2 Region: 10-81
Classification Level Classification E-value
Superfamily RING/U-box 2.91e-19
Family RING finger domain, C3HC4 0.0039
Further Details:      
 
Domain Number 3 Region: 126-183
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000305
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008192   Gene: ENSTNIG00000005497   Transcript: ENSTNIT00000008358
Sequence length 526
Comment pep:novel chromosome:TETRAODON8:Un_random:17527104:17531155:-1 gene:ENSTNIG00000005497 transcript:ENSTNIT00000008358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQGSFLSDEQFQCAICLDLFTNPSSTPCGHSFCLRCISEYWSSAKVCRCPLCKKNFQK
RPNLQINRTLQEITEQFKAMRKAGVTAMETRGDGGMPHSFVEEMKQSQSHFMKKLLMAPA
LKNTAASSSNLPLCKVHHRGLLIYCKNDQVCICPECETEDHYDHNTVTIKEEWMEKKVQL
HLSEQLIQEMIRQRIRKIEEIRESVSHTKLAVETETAGSVCLFSALTSAMESTQVELMET
MEESQKAAEQQADAMLGKLEEDNIVLQRRLSDLDELVQSDDYTHCIKTFPLLILPPPVQD
WSAVCISSCLGTSHIYKRLAAQMERFVEELKAVAEKGMKRLQEYAVDVTMDANTAHPRLI
ISDDMKSVWCSDHHQLLPDSQERFDRIVCVLGREMISSGKHYWEVDVTGKTDWDLGVARK
SVNRKGKITVTPSNGYWFLSLRDKNKYAFCTVHSSDVQLNLQPHKIGIFVDFENGQVSFY
NVNARVHIYTFNDSFSESIYPFFSPCSNKYGKNDEPLTITPVNVKK
Download sequence
Identical sequences H3CIW4
99883.ENSTNIP00000008192 ENSTNIP00000008192 ENSTNIP00000008192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]