SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008226 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008226
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.97e-22
Family MAM domain 0.0000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008226   Gene: ENSTNIG00000005527   Transcript: ENSTNIT00000008392
Sequence length 99
Comment pep:novel chromosome:TETRAODON8:Un_random:79019304:79019628:1 gene:ENSTNIG00000005527 transcript:ENSTNIT00000008392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSFMMVNSSQHLAGQRAQLLLQPLSENDTHCIQFSYFLFSRDGHSPGELQLYVRVNGGPK
GSAVWNTSGSQGRQWHQVELAVSTFWPSEYQLISHFQLH
Download sequence
Identical sequences H3CIZ7
ENSTNIP00000008226 99883.ENSTNIP00000008226 ENSTNIP00000008226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]