SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008291 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008291
Domain Number 1 Region: 3253-3357
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-30
Family Cadherin 0.00048
Further Details:      
 
Domain Number 2 Region: 1015-1133
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-28
Family Cadherin 0.00078
Further Details:      
 
Domain Number 3 Region: 1536-1639
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-27
Family Cadherin 0.00057
Further Details:      
 
Domain Number 4 Region: 2789-2897
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-27
Family Cadherin 0.00037
Further Details:      
 
Domain Number 5 Region: 1127-1234
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-26
Family Cadherin 0.00063
Further Details:      
 
Domain Number 6 Region: 2257-2362
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 2564-2703
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-25
Family Cadherin 0.0032
Further Details:      
 
Domain Number 8 Region: 1431-1536
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-25
Family Cadherin 0.00097
Further Details:      
 
Domain Number 9 Region: 916-1019
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-24
Family Cadherin 0.0019
Further Details:      
 
Domain Number 10 Region: 3738-3925
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-24
Family Laminin G-like module 0.0087
Further Details:      
 
Domain Number 11 Region: 452-554
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-24
Family Cadherin 0.00084
Further Details:      
 
Domain Number 12 Region: 704-816
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 13 Region: 135-257
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-23
Family Cadherin 0.0014
Further Details:      
 
Domain Number 14 Region: 1740-1860
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 15 Region: 810-914
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-22
Family Cadherin 0.00094
Further Details:      
 
Domain Number 16 Region: 1641-1762
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-21
Family Cadherin 0.0007
Further Details:      
 
Domain Number 17 Region: 2466-2576
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 18 Region: 2049-2157
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 19 Region: 3358-3462
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 20 Region: 2363-2462
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-19
Family Cadherin 0.0017
Further Details:      
 
Domain Number 21 Region: 2157-2264
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-18
Family Cadherin 0.001
Further Details:      
 
Domain Number 22 Region: 2898-3009
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-18
Family Cadherin 0.0023
Further Details:      
 
Domain Number 23 Region: 1848-1976
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-18
Family Cadherin 0.0024
Further Details:      
 
Domain Number 24 Region: 1339-1437
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-18
Family Cadherin 0.0046
Further Details:      
 
Domain Number 25 Region: 1236-1336
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-16
Family Cadherin 0.0034
Further Details:      
 
Domain Number 26 Region: 557-657
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-16
Family Cadherin 0.0014
Further Details:      
 
Domain Number 27 Region: 1958-2061
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000628
Family Cadherin 0.0041
Further Details:      
 
Domain Number 28 Region: 3202-3260
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000126
Family Cadherin 0.0074
Further Details:      
 
Domain Number 29 Region: 2681-2795
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000557
Family Cadherin 0.0027
Further Details:      
 
Domain Number 30 Region: 361-445
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000657
Family Cadherin 0.0042
Further Details:      
 
Domain Number 31 Region: 31-147
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000377
Family Cadherin 0.0066
Further Details:      
 
Domain Number 32 Region: 3993-4027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000594
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 33 Region: 3466-3557
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000771
Family Cadherin 0.011
Further Details:      
 
Domain Number 34 Region: 4057-4097
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000234
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 35 Region: 248-350
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000286
Family Cadherin 0.01
Further Details:      
 
Domain Number 36 Region: 3956-3993
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00002
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008291
Domain Number - Region: 3073-3115
Classification Level Classification E-value
Superfamily Cadherin-like 0.0989
Family Cadherin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008291   Gene: ENSTNIG00000005590   Transcript: ENSTNIT00000008457
Sequence length 4430
Comment pep:novel chromosome:TETRAODON8:Un_random:19643659:19671995:1 gene:ENSTNIG00000005590 transcript:ENSTNIT00000008457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLLPLLLLKPPCCSGQTWERPRAEPQFSFTQAGYHATIYENSAARTYARSRVKMGIHR
GQSSWDVRYRISTGDEEGFFKAEEYILGDFCFLRIRTKGGNAAMLNREIQDNYLLTVKAS
VKGDALLETWTKVSVQVLDMNDLRPLFSPTTYSVTIMESTPLRTSIAQVTATDADIGSNG
EFYYFLKNKMDLFAVHPTSGVVLLSGKLNVDERYQHDLEILAVDRGMKLYGNNGVSSTAK
LIVHVERVNEHAPVISVVNSSPWSHANSPIYAVVTVEDPDPGLNGEVDSVVILGGDLSEK
FFLERSEENEFFIRATESLNWETHPRGCNLTLQAADRGTPQKVSVKVVQIMDEKQSKVAA
MFEKEVYNVSLSEFSPPGTVVQVVKIKPESSYVEYTLTPSADSAFFRVNGVTGVISTTQW
FTGVSQSLFKLDVLEMDSELKAQVQVAIQDANDNTPTFHQSSYEILVNESVPVGTSVLTV
SAQDGDDGENGYITYSISSLGALPFQINQFSGVITTTEPLDFDFSSDSFVFIVRASDWGS
PYRRESEVYVTIHVKNVNDNQPLFEKTACHGVISRDLPADQVITTVSAIDIDELALVKYK
IVSGNTLGLFNLNPDSGVLSLQRSLVPAVSANAFSLKITATDGENLSEPMYVNISVVEGK
SFSKNINCKETMVAQRLAEKLLKKSKGSAAPKSEEGFIDIFSINRQTPQFSKAFPTDIAV
REDLGVGSSVFQVSAYDGDTGFNGQILYSISDGNPDDCFTMDTDTGLISVLLPLDREKKD
HYLLNLTIYDLGRPPKSAWHLLTVFIEDANDNAPQFLQEGGYTVVLPENTAIGTDVIQVG
ATDRDAGPNGEVAYSLLTATANFGINSTSGVVYVAGQLDRELVSVFYLKVEARDKAEQGS
QRFSVTTLKVVLEDVNDCPPVFIPSVYKTRALEDLPVGTVLAWLETQDPDLGPGGQVQYS
LANDYNGWFEVDRTSGAIRLMKELDYETQQFYNLSVKAKDRGKPVALLSVTSVEVEVVDV
NENLNAPYFSHFALKATVKENARIGTTLLQVAAQDDDVGRDGEIQYSIRDGSGLGRFAIN
EETGVIYTTDTLDRETKDSYWLTVYATDRGVVPQFATIAVFVQVEDVNDNAPLTSEAMYD
SSVQENSPEGVSVVQIQAQDPDETPLTAEKLSFHIVSGNPQNLFAINSHTGLITTTSRKL
DREQQTEHNLEVMVSDSGPSPKHSVVWVTVRVLDDNDNKPIFPEKVYQVKLAERERRKKA
EPIYRVFAYDGDQGPNSDLSYSIADGNEDAKFFIDPKTAVLSSRKAFAAGTYNILTIKAT
DNGRPQKSSTARLHIEWLFDQPFYNFTVMESDKVSEMVGVVSLRRSAATVWFDITGGNSE
SVFHVDKTVGTIIIAKPLDAEQQSFYNLTVQATDGTKAAFAQVHVTVLDTNDNAPIFSQP
TYEVTVPEDIPADTEVIQVVAVDRDRHHQLSYSLQSSIDPSSMRFFHIHPTLGTIHTLQS
LDHEACALHILTITVKDQEFPYRKNMARVLIEVKDVNDHVPIFTRSTYEGSVCESSAVGS
AVVQVSALDKDKGENADVQYSIESGNKGNTFHIEPILGIITISHDLNLSSIGHYVLTVRA
TDKGSPPLSTTTMVHISVTLSDNAAPKFPQEEYLAVITENVAVGTSIITVSAVSQTTLTY
DIKQGDADGVFQINQYSGVITTRKALDYEKTASYSLIVQAVNMAGMASNATAIIQLKDEN
DNPPVFQQLRYHGSISEAAAVNSVVLNPDDSPLVIKATDADRNENALLVYQIVEDVAKMF
FAVDSGTGSIRTIASLDHETLAIFHFHVFVRDSGRPQLTADGPAEVTIQVMDTNDSPPQF
SQSSYETVLLRPTYAGVEVLQVKATDPDEDVSRNLTYSLTNGVLEHFAIEPLSGTIVVKQ
SNFSNERFLFGVRVSDGQFSSTALVNVLVREALDSGLSFSQSLYSSTIQENESGITQVAV
VNALGNQANEPIVYTLLNGGMYFKIRPTSGVIQTTGVAFDREEQESYELVVEARREDDHL
RVARVLVKVQVEDVNDNVPVFVGLPYYAAVQVDAEPGTAIFRVMAIDQDKGINGHVSYYL
LDDHGHFEINKLTGILSLKKAFESDLSNVEYQMVIYARDHGSIPLSSTTEFPITVVNKAM
PVFDKPFYSISVNEDVAVHTPVLGINATSPKGQSIIYTIVDGDPSLQFDIGFDTGVIAVI
HPLDHETAARYNLTVRATDCLTGAHAEVDVDVAVKDVNDNQPLFKKMAYQVVLSETVMIG
TPALHVSATDKDSDKNNVIHYQIFSDHNNTDYFHIDSSSGLILTARMLDHELVQKFDFVV
IATDNGFPPLSSEVSVTVMVSDINDNPPVFNQLLYEAYVDELAPRGHFVTCVQASDADSS
DYEKLEYSILSGNEKLVFMLDKMTGIVTLSSRYKQRMEPAYSLNISVSDGVFTSTAQVHI
KVSQGNLYAPVFEQNVYEAQVKENSVVGTRVVQVKATDSDPGVFGRVTYSFVNDVGRERF
SIDANGQITTAEKLDREDPSNQYVVVSVAAQDAGGHVSYATVQVSLVDENDNAPHFWATE
YRASVRSSVAEGFLLTQVQASDPDAGTNARITYSIYSDSHVPVTDILEIDPDNGWIVTKG
AFGHLMNSVLYFFVKAEDGGHPARHSLVSVYVHVLSPAASIPSFLQQHYEFSVAEDTSVG
TAVGMLRLKTPPGYASLSAVFSLVNGAMEKYNQDGVFVVEKDTGLIRLNKPLDHELIKEY
YFKATATVQQAKLDSVASVDVQVKVLDRNDNKPEFVTESFEAAVMEGVPLATRILQVRAL
DADSGANGQVRYSLSESQQETLFNTFSIDSQSGWISTLTNLDHETSSSYVFTVVASDFGE
ITSFSATATVTVVVTDVNDNPPRFLEQRYFGSVQEGSPPGEVVAALDTRDNDGSATNRHV
SYHITGGNYRGSFALGLVQGEWKLYVKFRLDREERSLYRINVSASDGLFVCHTLVHVSVL
DANDNSPVCDKVSPSEKKDALLRFPVAQLKEIKVKTRGGAKGGAGVGPWARQPDGANRLI
VAAAVEQAAYHLLSXITYSIRSGNQHGKFHIHPRTGEERRRAPEEHPIIVAVAMDAGTAG
VGSGRSRGLLHVTGLSFSISIKTKGDQQSSPSSILSLLPLIYYVAEPRTDDYRRMLMTAK
VVRWDFMNHRISTRLSCLVFPAFSPPSLPGAILVSQSLDYETCRDYFLTVEARDGGTPPL
SAITTVNVNVTDVNDNAPVFGCQLYAAVVSEGAATGSSVIQVVAEDADSKPNGAVSYSIT
SGNQGNQFSIDPASGIVRVNKDLDREAIPSYSLAISARDGGIPPLSSTTMVNVDISDVND
NAPVFALEDSTVVIQENKPIGTSILQFSVTDGDSSNNGPPFHFHILSGNDGKEFVLEKDG
TLVANQVFRRDLAAQYVLQVQVRDSGRPSLSSSSLLTVRVIEESLHRPVASPLEVHIVTV
EDEFPGGVIGQLHASDADPYDALTFGHASPGQRSLFKISPRDGKIIASGGLDAGRYSLNA
SVSDGRFLVSVPVSIHVVQASAEMLQEAVTVRFESVTPHDFVEFHLKSVLKVLRQIAASQ
QQDAVHLLSLQPVGGTQQLDMLVSVETAKEEYYKAAYLTQKLSASRRHLEELLRVSAILD
KNCSGLECPGAQCEQSLLLDSHNLSAYSTQRTSFVSPRFRRTSRCTCSDANCAVASEQCK
DHPCPDDMQCVSNTATRGHYACQCAPGKHGACTGHSSLSFSGVSYIRYRLYDLLPSEMKV
SFRIRTLQSRGVIMFTPTQPCMLLQLAEGKLWFRLACDLGGGPGGHAGGPGAMSISGSGV
SDGRWHTLVLELNRNFSSLTLDNRYGDGSRGPAFTHSLAAGTSVYFGALYFVLQVQSPKS
GLLDGQKDPEVLEGFQGCLDSVTINTNELPLHNKRSQHAEVVGLAEVKLGCVLYPDVCLQ
QPCQNGAACSSRPSGGFWCSCGPQHTGAYCETEVTACVPSPCQNGGACKSVGNAFLCSCR
RGFKGLTFRRFQHQHRPGSCEEFKSDNCFTLHSCGDDIDECDAANARRECENSGVCVNTH
GSFYCNCTAGFVGQRCSLRGVFVPDMQAGSAVVNKEELIGIALVVFIIVTLIVLFVAFRK
TVFQKNYSRNNLSLVQDPATAALLHKANGIQFQFLNCSPGDPFNLYTEAGLSPAGVGPPQ
VPVRPLPYTPCFQGEPRGALEKSERRVLEHTEMSTFHPESPKSTSGSIKRGVVVRLPPGL
PCQPDCDSICKSTWDARTKNSVPCFINDAAEEVVSCSQSNRDSNSEVQSLDSFQSDSCDD
NAYHWDISDWVPSSKLSPFQDVPGYEARLGGGAAGAATCPADAAQELESDYYLGGYDIDN
DCPPSHVEEFLSEDPLPPLPTDEDLPELYMPITSVSSHSTLSSGSTRAQR
Download sequence
Identical sequences H3CJ62
ENSTNIP00000008291 99883.ENSTNIP00000008291 ENSTNIP00000008291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]