SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008356 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008356
Domain Number 1 Region: 804-865
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000249
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 2 Region: 575-640
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000497
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 3 Region: 2-57
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000536
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 4 Region: 642-692
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000126
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 5 Region: 696-749
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000115
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 6 Region: 749-809
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 7 Region: 517-577
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000706
Family TSP-1 type 1 repeat 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008356   Gene: ENSTNIG00000018149   Transcript: ENSTNIT00000008522
Sequence length 914
Comment pep:novel chromosome:TETRAODON8:Un_random:22864584:22872976:1 gene:ENSTNIG00000018149 transcript:ENSTNIT00000008522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WWGEWSSWSSCSRSCGGGVRSQGRHCLIQRSIALPLTSPRQTVGSSKQYQLCPSEACPSP
SVSFKQHQCSQFNAKAFGRRYYQWVPLYPADYISISSKPCDLQCTTINGERQLLVPAQDG
TFCRDTKHHGVCIDGTCQPVGCDGKLYSSMAVDRCGVCGGDGTSCQRVSGSYRKALAQLG
YVFITNIPTGASDIQIIEKRKTENILALADEAGHFFFNGNSVFDNPQNFRVAGTVFKYRR
PSSVFSDGLEYIMAQGPTLQGLNVMVLKYYNLNGKTPHITYEYTLALPPLGVSGAAPDPV
NSYDNLTFNEVNEDGPPATNRSRGSAPVRPYDSQSHAQLREEAGTEEEVAWEVKTPSPPP
PAAILVYRPADISRHNDVEQPPGPSGYRRSTMETPAPRFRVCSHLLTDQCPLLQSLTSRC
RSQSPEAAPSLLQEDPNHQAQSGDQPGSQTVEQPTAETRRDQGSELPSASVRRLQSDTHS
STNAPTFLPSTEATLRGGGGARTARTPRPVHAQSETPADMYRWKVSAYAPCSSTCTTGIA
TSYALCVRYDGSEVDERFCDSVTRPEPTQEFCSGKECPPRWETSGWSQCSRTCGEGFQYR
AVRCWKMLSPGLDSSVYDSLCLSHDLHKPASRKVCQGQSCGPQWEVSDWSECSARCGSRG
VQTREVRCSTDMRLCNKSSQPIESQECEGPPCDRRWTVSDWGPCSGVCGEGRMARAVTCR
SSGGVVTSEEQCDQSLRPLAIYPCGDRDCAPHWVEQEWQQCNATCGRGVRQRQVVCAGLE
AGVFKEFPESSCARSNPPESFSSCFQRPCSKWFTTSWSQCTKTCGRGVQVREVKCYRGED
VVLRGRSCDSALRPEGRQSCQIQRCPPEPTASAPLEDSCRDKPTANCALVLKVKLCSHWY
YRRACCHACQAARP
Download sequence
Identical sequences H3CJC7
ENSTNIP00000008356 ENSTNIP00000008356 99883.ENSTNIP00000008356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]