SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008464 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008464
Domain Number 1 Region: 14-176
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-30
Family FCH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008464   Gene: ENSTNIG00000005749   Transcript: ENSTNIT00000008631
Sequence length 177
Comment pep:novel chromosome:TETRAODON8:Un_random:26301994:26303978:-1 gene:ENSTNIG00000005749 transcript:ENSTNIT00000008631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDPISTCCYNKLYQNVKRLSKAGEYFCKELMTVFQQRAELELTYAKGLQKLAGKLLRAS
KGMSQNSTYSAWCHMSDEMYSRADAHRSLGNAFQQEAILELRQLLDEHTKRKRPFDSAID
RTGKLVTLNWSEQLKVKKKLSGLTREHEALFNFVEGNKHICTKKEKQKMLNRLTKSA
Download sequence
Identical sequences H3CJN5
99883.ENSTNIP00000008464 ENSTNIP00000008464 ENSTNIP00000008464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]