SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008533 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008533
Domain Number 1 Region: 197-471
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-104
Family BEACH domain 0.0000001
Further Details:      
 
Domain Number 2 Region: 535-743,783-822
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.92e-31
Family WD40-repeat 0.001
Further Details:      
 
Domain Number 3 Region: 50-170
Classification Level Classification E-value
Superfamily PH domain-like 1.66e-22
Family PreBEACH PH-like domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008533   Gene: ENSTNIG00000005811   Transcript: ENSTNIT00000008701
Sequence length 824
Comment pep:novel chromosome:TETRAODON8:Un_random:81082386:81093801:1 gene:ENSTNIG00000005811 transcript:ENSTNIT00000008701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCERLTFFPKLNETHPIMEDHHSPVTPTPCSSAQDCPDIRIILQELHPQEEVKAKMGVVM
VSGLTVTEGVLLFGKESLLLCEGFTLSPTGDVCCRKHHPSSVRDAFISTMLTKEPISGKC
RRWLYDDIKEAFFMRFLLEDSAIEIFMKNGHSAFLVFLNRDHVSAYKRLCSVVSALKGRC
VSEVIANARKTSVVEKAVLLKWQKGEISNFEYLMHLNTVAGRTYNDLMQYPVFPWILADY
HSETLDLSNPATFRDLSKPMGAQTEKRRQMFMERYAEVEKSEAEGDLSAQCHYCTHYSSA
IIVASFLVRIEPFSHTFQTLQGGFDIPERMFYNVKKEWESASRDNMGDVRELIPEFFYLP
DFLLNSNNIHLGSMEDGTEISDFRRFSSFHRQALESDYVSSHLHLWIDLIFGYKQQGPAA
VESMNTYHPYFYAQRDRQNPKDPIIRNIMLGYVSNFGQIPKQLFTKPHPPRSGSKKEAPP
LSHPIPFFFKLDKLKTTAQPFKDSTHNATLSLELRRGPVGQIVCLEKEVVVLERNCLLLS
PLLGCFFSWGFPDNSCAFGNHATGKIFAVFEGLSDWGETLCAASPNPTTVVTAGTSTVVC
VWDITVEKDKVTCMRLRQLLYGHTDSVTCLAASEVHNLIVSGSRDLTCILWDMEDFSYIT
QLTGHTASISSLAINDLTGEIASCAGPLLYLWNMKGQLLSRSQASFGPLPHILCVGFTQH
HEWDPRNVIVAGCADGIIRIWKTEYTRTQLPGPPEEPVSPASEPSRQEGWERHLVLCKEL
SRRQSASPRRYKNSPGVTALAISRSHATLVAGDAWGRVFTWTCE
Download sequence
Identical sequences H3CJV4
99883.ENSTNIP00000008533 ENSTNIP00000008533 ENSTNIP00000008533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]