SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008546 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008546
Domain Number 1 Region: 4-112,200-308
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000000102
Family LacY-like proton/sugar symporter 0.081
Further Details:      
 
Domain Number 2 Region: 132-167
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000665
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008546   Gene: ENSTNIG00000005824   Transcript: ENSTNIT00000008714
Sequence length 341
Comment pep:novel chromosome:TETRAODON8:Un_random:81225160:81226606:-1 gene:ENSTNIG00000005824 transcript:ENSTNIT00000008714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIPRVTRHLLSNPVFSCITLAACMEIAVVAGFAAFLGKYLEQQFHLTTSSANQLLGMTAI
PCACLGIFLGGLLVKKLSLSALGAVRMAMLVNLVSTACYVSFLFLGCDTGPVAGVTVNYS
NETSPSRSPPAPSCISNCNCRTASASPVCGSNAVTYLSACFAGCTRANLSGCWCVSGSSA
QAVASPGRCPRPGCQEAFLTFLCVVCVCSMIGAMAQTPSVIILIRTVSPERKSYALGVLF
LLLRLIGFIPPPLIFGMGIDSTCLFWSTVCGERGACLLYDNLAYRHLYVSIAIVLKSSAF
LLYATTWRCLRKNYRQYIRNGEGALTPSQLFASSLTLDHLG
Download sequence
Identical sequences H3CJW7
ENSTNIP00000008546 99883.ENSTNIP00000008546 ENSTNIP00000008546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]