SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008583 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008583
Domain Number 1 Region: 998-1312
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 6.98e-59
Family Complement components 0.0000288
Further Details:      
 
Domain Number 2 Region: 1531-1684
Classification Level Classification E-value
Superfamily TIMP-like 2.55e-31
Family Netrin-like domain (NTR/C345C module) 0.0001
Further Details:      
 
Domain Number 3 Region: 1383-1532
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.75e-18
Family Alpha-macroglobulin receptor domain 0.0042
Further Details:      
 
Domain Number 4 Region: 688-747
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 0.000000000458
Family Anaphylotoxins (complement system) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008583   Gene: ENSTNIG00000005860   Transcript: ENSTNIT00000008751
Sequence length 1688
Comment pep:novel chromosome:TETRAODON8:12:12409486:12418126:-1 gene:ENSTNIG00000005860 transcript:ENSTNIT00000008751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRGHVCLLVGVEANGGPAPRYLITAPLSLRLDAVETVLLQLFGFTSEVKVYVFLKTSMAP
DHVVLAQEVVTLNTQNRHQAAAKVRLYPGQLQRTASHVILHVQSAEINQHLSIPVSRTNG
FLFIQTDKPLYTPHQSAVKVRAFSLNQELRPANRSVFLTFKDPDRITVDVAEMIDVNNGI
PSMQNPFRIPIKPKLGIWSIEAAYSGDFTTAARTDFEVKEYVLPSFSILVKPEQNYISFG
NFRSFSFQVSVRYLHGAPVADGVVFLRYGYVSGKAPAVLIPTSVSRERLSSTGEVSVTVN
MEKVLSKHDGPRDLGALVGKHLYIAVLVQEDTGGISEEAEFSAVKFVKSPYRLSLVSTPP
FIKPGLPYHISVAVKDHLDKPVKGVVVALVRRQLFRRGEQEEMPCTPRSTSSSSGIAFIC
NVPKEASKAALTVRTSLKQADPVLPAASQAQLDLLPLSYHSPNQRYLYIDPPLPGQGLEV
GSFANINVYSATPTYIPVRALSFLVLSRGKVVDFGSVAFVSSTDHRQTLNFEVTPAMVPS
VRLLVYYILFGEGTSELVADSVWLDVRDKCVNGLQVDAADQRQEHKPKDNLQMKIVANQD
GLVALSARDSALFALRPNYKDPVSTVLRHLEQSDRGCGGGGGRDSADVFRLAGLTFLTNA
NAQAATSSDACTAATRTRRALSDEEKKKKAASSFGPLRSCCLQGMRFIPKTLSCLQLSRQ
RFHKHPRCGDVFRTCCEFVQQQLDQDQSLILGRHELGADFDQEPSLIRSYFPESWMWEVQ
RVSPGQTSLTRTLPDSLTTWDVQAVGMFQNGICVADPVQVSVSLPLSLDVPVPYQVVRGE
QLELTGSVYNQLADGVTYCVTLLAEAAVCLTDSQPAPGRAGLRSTGCTWTPLFAGGVGKV
AFTVLGLEPGEHRLTFVLKTRRGHKDILEKKLRVVPEGVRREQLSGGRLDPQGLYGSEKI
SVELRNTLPASRVPNTAVERMLTINGEVLDQVVSVVHSADGLRQLASLPAGSAEAELGVL
LLQVQLYRYLETSRHWSVLGADIGKSSGQLKEKIRQAGLVSVSSFRRGDSSFSMWVNKGP
STWLTALVVKILAQVDPVVPVDRQALSESVAWLIRKSQQPDGSFEEPSSYRPNRIVVSQA
AGAVDRSVFITSFVLIALQRATSINEPILQLRVSMRAAAAYISQHAVGVASVYVRAVATF
ALTLYDSNSMAASTLLSSLENLARERGHPAVIRYWQDGERSSEWLKPDQSSGVTVETTAY
VLLSFLLKGRIHYANPVLTWLTQDHQYGGAFYSGQQDTALTLEALTEYSRVVPRAALSLD
ISVRYSRKGPLGRVQLSQSRPVATPIQVTKDDSIHVSTGYGTGVSSVKLKTVYYETTAST
QRCNFDVTVEVVDPDTANNPRITSPTLVACAKFKPPPNELLTESGLTVMKIQLPTGVEPH
LEDLKQFQDGDEPLVSHYELQGDTVVIQMDAVPSEVFVCVEFRVRSRFVVRGSSVSVLSI
YEPQDKGTMCTKEFSYQEQKLQRLCVAEQCQCMAAACATYRGGVDVTLTAARRTSETCRP
QIRYAYKVMVKSSAAEGDFMTYAATVVEVLKNSDKELEAVSSGTPVELVKRATCTSVEIQ
ENQQYLLMGSGGSEIRLERSFRYRLPLDSEALLELWPTDCGSPECLDFVSQLDDFALDLQ
LMSCADAS
Download sequence
Identical sequences H3CK04
99883.ENSTNIP00000008583 ENSTNIP00000008583 ENSTNIP00000008583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]