SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008677 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000008677
Domain Number - Region: 19-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000146
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008677   Gene: ENSTNIG00000005942   Transcript: ENSTNIT00000008846
Sequence length 59
Comment pep:novel chromosome:TETRAODON8:Un_random:82895873:82897076:-1 gene:ENSTNIG00000005942 transcript:ENSTNIT00000008846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTCPTGQTALSCGSKSVQNCNIRCMNGGTCAEDHCLCQKGYIGKHCGQPVCENGCLNG
Download sequence
Identical sequences H3CK98
ENSTNIP00000008677 99883.ENSTNIP00000008677 ENSTNIP00000008677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]