SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008680 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008680
Domain Number 1 Region: 96-293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-17
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 2 Region: 29-88
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000613
Family Laminin G-like module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008680   Gene: ENSTNIG00000005945   Transcript: ENSTNIT00000008849
Sequence length 301
Comment pep:novel chromosome:TETRAODON8:Un_random:83059079:83060776:1 gene:ENSTNIG00000005945 transcript:ENSTNIT00000008849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RILQYGQMSMSSEATEGEERVIKASVEAGGDQGLLNLLTDDTVFYVGGYPTTFSPPLQLT
LPNFKGCIELETLNEEVLSLYNFERSFQLNTTKEKPCGRHRSKPALTQAWVNDAAYFDGT
GFAQITFAEESTRMQRFEQEVKLLSQDGILLLLHNENQFLCLAVLQGQLKVFYDFTGDLV
ELEPKDPSSEYLRISDADPKTIEIIVLRSSTNRVVVRNNRMGLYTHTFTENIPSFSHSYY
LGGVPQDKMPAQLKSLFPKQGSLKGCFRNVKAQNSHIDLKRMISSGVSFGCNSDLLVRKK
S
Download sequence
Identical sequences H3CKA1
99883.ENSTNIP00000008680 ENSTNIP00000008680 ENSTNIP00000008680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]