SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008735 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008735
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.67e-26
Family Fibrinogen C-terminal domain-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008735   Gene: ENSTNIG00000005995   Transcript: ENSTNIT00000008905
Sequence length 68
Comment pep:novel chromosome:TETRAODON8:Un_random:84396971:84397177:1 gene:ENSTNIG00000005995 transcript:ENSTNIT00000008905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSGPFKDCLQALEDGHTTSGMYLVKPENANRLMQVWCDQRHDPGGWTVIQRRVDGSVNFF
RNWETYKV
Download sequence
Identical sequences Q4SWS8
ENSTNIP00000008735 ENSTNIP00000008735 99883.ENSTNIP00000008735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]