SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008866 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008866
Domain Number 1 Region: 1-232
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.15e-66
Family Fibrinogen C-terminal domain-like 0.00000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008866   Gene: ENSTNIG00000006122   Transcript: ENSTNIT00000009037
Sequence length 233
Comment pep:novel chromosome:TETRAODON8:19:6926075:6927666:-1 gene:ENSTNIG00000006122 transcript:ENSTNIT00000009037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCGQIKDRFPRAPSGVYSITPDLRKASFKKTQKVYCEMRTNGAWTVFQRRSSARCTFNRK
WTAFRNGFGGLKSDHWLGLRKVFALTKNKSRKWILRVDLWDHEGNSAFAQYSDFRLGDEK
SAFKLHVGQFSGNAGDAIRGRHSGVDQNGFGFSTIDRDNDGCSPCIFGDIAETECASSSG
GAWWFSRCGSAALNGDWHPAGDHIGWASGLHWDTWKTFAPYSLKATRMMIKSV
Download sequence
Identical sequences H3CKT7
ENSTNIP00000008866 ENSTNIP00000008866 99883.ENSTNIP00000008866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]