SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008968 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008968
Domain Number 1 Region: 128-184
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000249
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 1201-1258
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000262
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 548-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000536
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 953-1009
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 691-744
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000353
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 6 Region: 286-339
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000314
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 7 Region: 615-686
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.012
Further Details:      
 
Domain Number 8 Region: 346-428
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 9 Region: 1080-1134
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000405
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 
Domain Number 10 Region: 822-877
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000458
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 11 Region: 1329-1393
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000262
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 12 Region: 1253-1308
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000837
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008968
Domain Number - Region: 431-492
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000222
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Domain Number - Region: 1135-1197
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000262
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number - Region: 1008-1067
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00196
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number - Region: 55-127
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00432
Family TSP-1 type 1 repeat 0.0093
Further Details:      
 
Domain Number - Region: 751-821
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00562
Family TSP-1 type 1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008968   Gene: ENSTNIG00000006219   Transcript: ENSTNIT00000009139
Sequence length 1580
Comment pep:novel chromosome:TETRAODON8:17:688672:704988:-1 gene:ENSTNIG00000006219 transcript:ENSTNIT00000009139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPWGRCMGSGCGPGGNQSRTVWCAHSEGWTTLLTNCNQTERPNNQQSCFRVCDQHKELYD
WQLGAWNQCVPISMRGGGLQPPSVCTRGEEGIQTREVSCVQKSGEAAQDAICEYFEPKPR
LEQACLIPCPQDCVVSNFSAWTPCSKTCGLGLQNRIRVVLAPPLFGGAACPNLTEFQTCQ
LKQCEGPESLYSLRVGPWGPCSVPAPRQARHAGDPGTESTRLSTETEKHPQEGEKSSKGG
KFWDVQVGYQTREVTCVHKNGNVETLSMCSQETTPVTFQACVITKDCVVSEWSQWAVCSK
DCYDPNGPKGQRARSRRVSQFPVAGGKVCPQLEETEPCSPQGDGVHPCIVYSWRSSEWSE
CRVDVLLSQQDRRRGNQTSLCGGGIQTREVYCVQISSDPGSLRGKEALRPVASELCLDLP
PNTTQLCHISCPVECEVSAWSAWGPCTYENCQDQSTKKGFKLRKRKIINEPTGGTGNCPH
LVEAIPCEEPSCYDWLVVTLDECLPDNRECGPGTQVPQVQCVNSDGVFVERQMCRDAILP
MPLMCEVPCPKDCALSPWTSWSHCSHTCSGKNTEGKQTRARSILAYNAGEGGILCPNVST
LQEVRSCNEHPCTVYHWQTGTWGQCTEDTSIPTSNTSVDQSRGSDASCSVGMQTRKVICV
RVNVGQVPPKKCPESVRPDTVRPCLLPCKRDCVVTPYSDWTPCPSSCDADGSRKKKQYRK
RIIMQPPANGGQDCPETLSQERNCDIPSVCQGYRWKTHKWRRCQLVPWTVRQDSPGAQET
CGPGMQVRAVSCRKQDGSQADVEACLKFASAMPPLTQLCQLPCQEDCQLSHWSKFSPCTA
DCIGVRTRKRMLMGKSKKREQCRNHQMYPLSETQYCPCNKYNAQPVGNWSDCVLPEGGRF
EGQLGMKVQGDIKECGQGYRYQAMACYNQDNQIVETSRCNSHGYIEEACIIACPSDCKLS
EWSNWSRCSKSCGSGVKVRSKWLREKPYNGGRPCPKLDHVNQVYEVVPCLSDCGQYVWVA
EPWSVWKVSNVDLKDNCGEGVQTRKVRCVLNTVDGPSEQVEDYLCDPEKMLLGARNSRLP
CPEDCVLSDWGGWSSCPLPCHVNSTRRRSAYLLRQPGAEKVCPPTEETEPCTLNSNCFHY
SYNITDWSTCQLSDRAVCGSGIKTRMLDCVRSDGKSVDLNFCKELDLERKWQMNASCVVE
CPVNCQLSDWSPWSQCTHTCGLAGKLWRRRTVIQAPQGDGRPCPPQMEQWKPCLVQPCFH
WRYSSWSECRTEGARCGEGLRVRNVSCFVSDGAEQQDSSSMVDDELCGDLEPSVDGEPHV
VLQETCTVPCPGECYLTEWTTWSRCQISCVNGDDLGFGSVQVRSRAVVAQDPENLLQCPE
QELEARPCTEGKCLEYRWKTGPWRGSSRPVWCERTDGLNVTGGCPVSTKPMADRSCDPAC
TKPRSLCTEAGVCGCEEGYTEVMTSDGLLDQCTVIPVLEIPTAGDNRADVKTIRAFSPTQ
PEASVPGRAGRTWFLQPFSPGTDGKLKTWVYGVAAGAFVLLVFIISMTYLACKKPKRPQR
RQMNNRLKPLTLAYDGDADM
Download sequence
Identical sequences H3CL39
ENSTNIP00000008968 99883.ENSTNIP00000008968 ENSTNIP00000008968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]