SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009097 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009097
Domain Number 1 Region: 11-115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-31
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 2 Region: 131-254
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-19
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 3 Region: 252-288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009097   Gene: ENSTNIG00000006336   Transcript: ENSTNIT00000009268
Sequence length 495
Comment pep:novel chromosome:TETRAODON8:Un_random:19995504:20000951:-1 gene:ENSTNIG00000006336 transcript:ENSTNIT00000009268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCGTWVKEPDGGYFTSPNYPEKYPPDRECVYIIEASPRQCIDLFFDDKYSIEPSWECKFD
HIEVRDGPFGFSALIGRYCGQESPAYVRSSGRYLYIKFVADGELEAIGFSARYNFTQDPE
FEYLGEVPALTPCDFELSGPEGFVESSQISGETRVLQSEAVDCRWHIRAPPRSKIYMRFL
EYEMHNSNECKRNFVAIYDGSSSVEHLKNKFCSTVANDVMLGSSVGVVRLWADEGSRKSK
FRILFTTFHEPPCEGDTFFCHSNMCINHTLVCNGIQNCVYPWDENHCKERRKHSILETLD
HTNLTIIGVTCGLVLILLIISVIIQLKQPRKKYIIRREDFDPALLHPGVEPPHYELCTLR
RAPSGDLADAALDEDFDKFHKLHRSSSKCIRDHHCGSQQGSVHGSLHGSRSNLSLRDAAI
PADGGALVPPGPLSQQSPRLSQHVAPAGRRSVVVMKHSCSQDGAERYRMDEGSTISRHHH
HFHHYSSGHEHAVHR
Download sequence
Identical sequences H3CLG8
ENSTNIP00000009097 ENSTNIP00000009097 99883.ENSTNIP00000009097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]