SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009154 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009154
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-19
Family DBL homology domain (DH-domain) 0.00074
Further Details:      
 
Domain Number 2 Region: 216-293
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-18
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 3 Region: 85-251
Classification Level Classification E-value
Superfamily PH domain-like 6.75e-17
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009154   Gene: ENSTNIG00000006388   Transcript: ENSTNIT00000009325
Sequence length 312
Comment pep:novel chromosome:TETRAODON8:Un_random:86293507:86296546:-1 gene:ENSTNIG00000006388 transcript:ENSTNIT00000009325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NQAFREAMALLEKHPRVRGLSFTSFLILPFQRITRLKLLVQNILKKAEENSEREANAIKA
HQQLEQIVKECNEGVRKMSRTEGLINIEKKLEFKCKSVPIISHSRWLLKKGEVQQMSGPH
STRTMRSRKLYQPLYLFLFNNLLLVTKRSSSGDKFQVLNSCTRAMLRTDDLEDQGQLLAN
VFNLRLLENQEDREVRYMLKTTSMSDKLRWMYALTPNRRTRFMSTSSHQTDSPQVQCIQS
YSSQEPDELSIEMADVLNLLERTDDGWMMGERLHDGERGWFPSRVVEEIQSKEVRAQNLR
EAFRIQQAQEGG
Download sequence
Identical sequences H3CLM5
ENSTNIP00000009154 99883.ENSTNIP00000009154 ENSTNIP00000009154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]