SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009183 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009183
Domain Number 1 Region: 92-137
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000471
Family Ovomucoid domain III-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009183   Gene: ENSTNIG00000006415   Transcript: ENSTNIT00000009354
Sequence length 190
Comment pep:novel chromosome:TETRAODON8:2_random:1112209:1121139:-1 gene:ENSTNIG00000006415 transcript:ENSTNIT00000009354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISINYCFLFLFPAAAALSMPQEVEDDYIKNGDENTASDEAVDTTKDPCQNVKCSRHKVC
VAQGYQRAMCVNRRKLEQKVQQPGQPEGHERSCKSCPVTVPSPVCGSDGHNYASECKLEQ
QACLTGKDLSVMCTGFCPCAASTITESKRGKQLHPPGPGRPGRPSQGLVPAAPWQRQAEQ
LRQAWIGHEL
Download sequence
Identical sequences Q4SV13
99883.ENSTNIP00000009183 ENSTNIP00000009183 ENSTNIP00000009183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]