SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009197 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009197
Domain Number 1 Region: 51-127
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.0044
Further Details:      
 
Domain Number 2 Region: 115-187
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000691
Family Fibronectin type I module 0.096
Further Details:      
 
Domain Number 3 Region: 213-258
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000209
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009197   Gene: ENSTNIG00000006429   Transcript: ENSTNIT00000009368
Sequence length 366
Comment pep:novel chromosome:TETRAODON8:21:866191:868339:-1 gene:ENSTNIG00000006429 transcript:ENSTNIT00000009368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLLLWILTAAGIQQVGTKASPASSHNLTAVPAVASAAPDAHSRTQYCKWPCVCPDAPP
TCPPGVSLLVDGCDCCKTCARQVGEGCDEAATCDHHRGLYCDYSADKPRYEKGVCAYMAG
SGCEHDGVIYRNGQSFAPSCKYQCVCVNGAIGCVGLCAESQPPPRVWCQAPRRVKVPGQC
CERWICDEARRGRKTAPRHAIEAAPAETRSWHRNCIPQTSSWSPCSRSCGRGLSLRVSNA
NERCELVKESRLCNLRPCEVNITGYIKPGKKCLNIYREELPSNLTISGCTSKRPYRPKYC
GVCTDERCCIPYKSRTVEVEFQCPNGTGFSWKMLWIQACFCNLSCRNPNDIFTELDSYYG
YSEIVN
Download sequence
Identical sequences H3CLR8
ENSTNIP00000009197 99883.ENSTNIP00000009197 ENSTNIP00000009197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]