SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009226 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009226
Domain Number 1 Region: 53-563
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.77e-179
Family Myeloperoxidase-like 0.000000000000499
Further Details:      
 
Domain Number 2 Region: 12-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family EGF-type module 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009226   Gene: ENSTNIG00000006458   Transcript: ENSTNIT00000009397
Sequence length 581
Comment pep:novel chromosome:TETRAODON8:4:7129064:7132249:1 gene:ENSTNIG00000006458 transcript:ENSTNIT00000009397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELVSDAFLSSPVNPCCYLPCQHWGVCVRYGLDQYQCDCTRTGYYGENCTVPEFWTRVRLL
LRPSPDGAHYILTHFQWLWDIVNHTFLRDFLMRLVITGTVRSNLVPYPPTYNSKYGYLNW
ESMSNLSYYTRILPPVPEDCPTPMGVKGKEELPDPELLVERLLRRRTFRPDPQGTNLMFA
FFAQHFTHQFFKTYNRMGLGFTKALDHGVGAGHIYGDTLDRQLQLRLHKDGKLKFQVLEG
EVYPPSGMDVPIRMNYPSRIPPEKTFAIGQEMFGIIPGLTMYATLWLREHNRVCDILKAE
HPTWDDEQLFQTSRLIIIGETIKIVIEEYVQQLSGYLLDLKFDPAMLFNTQFQYGNRIAL
EFTQLYHWHPLMPDRFLIDGDEVLYEQFLYNTSVLIHYGVDKMVEAFSLQAAGQIGGGHN
VPAMLTDVAVRTIKESRQLRLQPFNEYRKRFNLQPYTSFREFTDNEEIARELEEFYGDID
ALEYYPGLMLEKTRPGAIFGESMVEMGAPYSLKGLLGNPICSPEYWKPSTFGGKVGFDIV
NSATLKDLVCYNTKTCPFVAFRVPKEAQSQSTGSKGRTDEL
Download sequence
Identical sequences H3CLU7
ENSTNIP00000009226 99883.ENSTNIP00000009226 ENSTNIP00000009226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]